KEGG   Natrialba magadii: Nmag_3465Help
Entry
Nmag_3465         CDS       T01176                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nmg  Natrialba magadii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nmag_3465
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nmag_3465
Enzymes [BR:nmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Nmag_3465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3601934..3602860
Genome map
AA seq 308 aa AA seqDB search
MRHDHLITSKQLSRADIETVLDRAAEIADDPDAVANRHANAVLGLLFFEPSTRTKMSFET
AMKRLGGSVVDMGSVESSSVKKGETLADTVRVIEGYADSLVLRHPKQGAAAMACEFVDVP
LLNAGDGAGHHPTQTMLDLYTIRENAGLDDLTIGIMGDLKYGRTVHSLSYALTNFDTHQH
FISPESLQLPREVVYDLHQQDDTQIREHEALESVLPSLDVLYVTRIQRERFPDENEYQKV
AGEYQIDLETLEDASDDLTIMHPLPRVDEIAPEIDETEHAAYFEQAHNGVPVRMALLDLL
LSGGETDE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacgatcacctcatcacgagcaaacaactctcgcgggcggacatcgagactgtc
ctcgatcgggcagccgagatcgccgacgatccggatgccgtcgccaaccgccacgcgaac
gccgtgctcggcctgctctttttcgaaccaagcacacggacgaagatgagcttcgaaacc
gcgatgaagcgcctcggtggctccgtcgtcgacatgggctcggtcgagtcctcgagtgtc
aaaaagggggagacactcgcggacaccgtccgcgtcatcgagggctacgccgactccctc
gtccttcgtcaccccaaacagggagccgccgcgatggcatgcgagttcgtcgacgtccca
ctgctgaacgccggcgacggcgcgggccaccacccaacccagacgatgctcgacctctac
acgattcgagaaaacgcagggctggacgacctcaccatcggcatcatgggcgatctgaag
tacggccgcaccgtccactcgctgtcctacgcgctcaccaacttcgacacacaccagcac
ttcatcagccccgagagcctgcaactgcctcgcgaagtcgtctacgacctccaccagcaa
gacgacacccagatccgcgaacacgaggcactcgagtccgtccttccctcgctcgacgtg
ctctacgtcacgcggattcagcgcgagcggttcccggacgagaacgagtatcagaaggtc
gccggcgagtaccagatcgatctggagacactcgaggacgcgagtgacgacctgacgatc
atgcacccgctgccgcgggtcgacgagattgcgccggaaatcgacgagacggagcacgcg
gcgtacttcgagcaggcacacaacggggtgccggtgcggatggcgctgcttgatctgttg
ctgtcaggaggtgagaccgatgagtga

DBGET integrated database retrieval system