KEGG   Natrialba magadii: Nmag_3539Help
Entry
Nmag_3539         CDS       T01176                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nmg  Natrialba magadii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nmag_3539
Enzymes [BR:nmg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Nmag_3539
Peptidases [BR:nmg01002]
 Cysteine Peptidases
  Family C44
   Nmag_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3678230..3679399
Genome map
AA seq 389 aa AA seqDB search
MTRDESVSSAAPVSPPPLRGTDLDTVRAALESREPLPGTPGFAGVVEIDGQDHLVRDVLG
RVPLFVERDQPPTPNPTPADAWAYTPEELDAPLPFPAGAVATPDDSAPQQRWTLPEPDPI
EDSDTARAVLESAIETATTEAAATDAEIAVAFSGGVDSALVAELLDAPLYVVGFPDSHDV
EAARSAAAAMGRELTVVELEPADLERAVPEIARATGRTNAMDIQIALPLYLVGERVAADG
FDALAVGQGADELFGGYEKVVRLDHRVEAETTRGAVREQIRSLPEQLPRDVRAIEAAGLE
PVAPLLHDDVVSAALRLPDDLLADEETRKRGFRQVAAEHLPETVAMRDKKAVQYGSLVAR
ELDRLARQAGYKRRMDDHVTKYVESLLEN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacacgagacgagtctgtgtcctcagccgcccccgtatcaccacccccactccgcgga
accgacctcgacacagtccgggccgcactcgagtcccgcgagccactgcccggcacgccc
ggcttcgctggtgtcgtcgaaattgacggccaggatcacctcgttcgcgacgttctgggc
cgcgtgccactgttcgtcgaacgcgatcagcctccgaccccgaacccaacaccggccgac
gcgtgggcgtacacccccgaagaactcgacgcaccactcccgtttcccgctggtgccgtc
gccacccctgacgacagcgcaccgcaacagcggtggacactccccgagcccgacccgatc
gaggactccgacacagcgcgggctgtactcgagtccgccatcgagacggcgacgaccgag
gccgctgcaactgacgcagagatcgcggttgccttctcgggtggcgtcgactccgcgctc
gtcgccgaactcctcgacgcgccgctgtacgtcgtcggcttcccggacagccacgacgtc
gaggcagcccgcagtgccgccgcagcgatgggccgcgaactaaccgtggtcgaactcgag
ccggccgacctcgagcgcgccgttcccgaaatcgcgcgcgcgaccgggcgcacgaacgcg
atggatattcagatcgcgctgccgctgtacctggtcggcgaacgcgtcgccgccgacggg
ttcgacgcgctcgcggttggacagggtgcggacgaactgttcggcggctacgagaaggta
gtccgactcgaccaccgcgtcgaggccgagacgacccgtggagccgtccgcgagcagatt
cgaagccttcccgagcagctcccacgggacgtacgcgccatcgaagctgccggcctcgag
ccggtcgcgccgctgttacacgatgacgttgttagtgcggcgcttcggctacccgacgac
ctgctcgccgacgaggagacgcgaaaacgcggcttccggcaagtcgcggccgagcacctg
ccggagacagtcgcgatgcgggacaaaaaggccgtgcagtacggcagtctcgtcgcgcgc
gaactcgaccggctggcccgccaggcgggctacaagcgccggatggacgaccacgtgacg
aagtacgtggaatcgctactcgagaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system