KEGG   Natrialba magadii: Nmag_3786Help
Entry
Nmag_3786         CDS       T01176                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
nmg  Natrialba magadii
Pathway
nmg00010  Glycolysis / Gluconeogenesis
nmg00071  Fatty acid degradation
nmg00350  Tyrosine metabolism
nmg00625  Chloroalkane and chloroalkene degradation
nmg00626  Naphthalene degradation
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01120  Microbial metabolism in diverse environments
nmg01130  Biosynthesis of antibiotics
nmg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_3786
  Lipid metabolism
   00071 Fatty acid degradation
    Nmag_3786
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nmag_3786
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nmag_3786
   00626 Naphthalene degradation
    Nmag_3786
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nmag_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 adh_short ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ADD07327
UniProt: D3T168
Position
pNMAG01:complement(167301..168398)
Genome map
AA seq 365 aa AA seqDB search
MRAAVLESYGDPLSIEEVDPPTPDPHGIVVDVEACGLCRSDWHAWQGHGEWADDQVPIGQ
ILGHEPAGRVAQVGERVDELAVGDRVAVPFNLGDGTCYYCRNGHGNVCEDGYALGFEPSV
PGAFAEQIHVPHADFNAVTLPEGVSAEAVAALGCRYVTAFHALAHRADIAAGDWVAVHGC
GGLGLAAVQIAAALGARVLAVDIRPAPLELASDLGAEVTIDGSEFEDGPEDSESDGDESV
PTAIKSRTDGGAHVSVDALGRAETCRNSVDCLRIRGTHVQVGLTTAAERGEIALPIDELA
RWDVTVVGSRGMPPSRYDELLRLIDAGTLDPEQLVTNRVALEDVSDRLAAMSGYETEGIE
VITEF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgcagtactcgagtcctacggcgacccactgtcgatcgaggaggtcgatcca
ccaacacccgacccgcacggtatcgtcgtcgacgtcgaggcctgtggcctctgccggagc
gactggcacgcctggcagggtcacggcgagtgggccgacgaccaggtaccgattggccag
attctcggccacgaacccgcaggtcgcgttgcacaggtcggcgagcgcgtcgacgaactc
gccgtcggcgaccgcgtagccgtgccgttcaacctcggcgacggtacctgctactactgt
cgaaacggccacgggaacgtctgcgaggacggctacgcgctcggcttcgaaccgagcgtc
cccggcgcgttcgccgagcagattcacgttccccacgcggacttcaacgccgttacgctt
cccgagggtgtctccgcggaagccgtcgccgcgctgggctgtcggtacgtcacggccttt
cacgcgctggcccaccgagccgacatcgcagccggcgactgggtcgccgtccacggctgc
ggcggcctcggactcgccgccgtccagatcgctgccgcactgggcgcgcgcgtactcgcc
gtcgatattcggccggcaccactcgagttggcgagcgatctcggtgcggaggtgacgatc
gacggatccgagttcgaggatggaccggaagacagcgagagcgacggcgacgagagcgtc
ccgaccgcaatcaagtctcgaaccgacggcggtgcacacgtttcggtcgacgcgctcggc
cgtgccgaaacgtgccggaatagcgtcgattgcctgcggattcgcggcacacacgttcag
gtcgggctcaccactgcggccgaacggggcgagattgcactgccgatcgacgaactcgct
cgctgggacgtgaccgtcgtcggctcccgcggcatgccaccctctcgctacgacgaactc
ctgcgactcatcgacgcgggcacgctcgaccccgagcaactcgtcacgaatcgggtggca
ctcgaggacgtctccgatcggctcgcggcgatgagcggatacgagacggaggggatcgaa
gtcatcactgagttttga

DBGET integrated database retrieval system