KEGG   Natrialba magadii: Nmag_3786Help
Entry
Nmag_3786         CDS       T01176                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Nmag_3786
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_3786
  Lipid metabolism
   00071 Fatty acid degradation
    Nmag_3786
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nmag_3786
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nmag_3786
   00626 Naphthalene degradation
    Nmag_3786
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nmag_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNMAG01:complement(167301..168398)
Genome map
AA seq 365 aa AA seqDB search
MRAAVLESYGDPLSIEEVDPPTPDPHGIVVDVEACGLCRSDWHAWQGHGEWADDQVPIGQ
ILGHEPAGRVAQVGERVDELAVGDRVAVPFNLGDGTCYYCRNGHGNVCEDGYALGFEPSV
PGAFAEQIHVPHADFNAVTLPEGVSAEAVAALGCRYVTAFHALAHRADIAAGDWVAVHGC
GGLGLAAVQIAAALGARVLAVDIRPAPLELASDLGAEVTIDGSEFEDGPEDSESDGDESV
PTAIKSRTDGGAHVSVDALGRAETCRNSVDCLRIRGTHVQVGLTTAAERGEIALPIDELA
RWDVTVVGSRGMPPSRYDELLRLIDAGTLDPEQLVTNRVALEDVSDRLAAMSGYETEGIE
VITEF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgcagtactcgagtcctacggcgacccactgtcgatcgaggaggtcgatcca
ccaacacccgacccgcacggtatcgtcgtcgacgtcgaggcctgtggcctctgccggagc
gactggcacgcctggcagggtcacggcgagtgggccgacgaccaggtaccgattggccag
attctcggccacgaacccgcaggtcgcgttgcacaggtcggcgagcgcgtcgacgaactc
gccgtcggcgaccgcgtagccgtgccgttcaacctcggcgacggtacctgctactactgt
cgaaacggccacgggaacgtctgcgaggacggctacgcgctcggcttcgaaccgagcgtc
cccggcgcgttcgccgagcagattcacgttccccacgcggacttcaacgccgttacgctt
cccgagggtgtctccgcggaagccgtcgccgcgctgggctgtcggtacgtcacggccttt
cacgcgctggcccaccgagccgacatcgcagccggcgactgggtcgccgtccacggctgc
ggcggcctcggactcgccgccgtccagatcgctgccgcactgggcgcgcgcgtactcgcc
gtcgatattcggccggcaccactcgagttggcgagcgatctcggtgcggaggtgacgatc
gacggatccgagttcgaggatggaccggaagacagcgagagcgacggcgacgagagcgtc
ccgaccgcaatcaagtctcgaaccgacggcggtgcacacgtttcggtcgacgcgctcggc
cgtgccgaaacgtgccggaatagcgtcgattgcctgcggattcgcggcacacacgttcag
gtcgggctcaccactgcggccgaacggggcgagattgcactgccgatcgacgaactcgct
cgctgggacgtgaccgtcgtcggctcccgcggcatgccaccctctcgctacgacgaactc
ctgcgactcatcgacgcgggcacgctcgaccccgagcaactcgtcacgaatcgggtggca
ctcgaggacgtctccgatcggctcgcggcgatgagcggatacgagacggaggggatcgaa
gtcatcactgagttttga

DBGET integrated database retrieval system