KEGG   Natrialba magadii: Nmag_3794Help
Entry
Nmag_3794         CDS       T01176                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:nmg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nmg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNMAG01:176722..177792
Genome map
AA seq 356 aa AA seqDB search
MRANTGSDTTSNETLRIGLNGFGRVGRSILRASLTEDAIDVVAVNDVMDDDDMEYLLRYD
SVHGRLPGVSREGSRLYANGHEVQLLSERDPTELPWDELDIDVAFEATGLFRTHDEAAQH
LDAGADKVIISAPPKGEKDVPMFVYGVNHEAYNGEDVLSNASCTTNSVAPVLQVLDEEFG
IVSGVLMTVHAYTGSQGLVDGPMDKRRRGRAAAENIVPTTTGAANSTIEILPGLEGKLDG
MAMRVPVPNGSITDITVNVEADITRDDLLEAIRGAADNGLAGVLGYTDDEIVSRDIVGLP
FASYVDLESAMVVANDIVKVLAWYDNEYGFSTQMLDLARYVATETDTIDTTGTITH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgaacacaggtagtgataccacatcgaacgagacgcttcggatcggactcaat
gggttcggacgagtcggacgaagcattctgcgtgcgtcgctgaccgaggatgcaatcgac
gtcgtcgccgtaaacgacgtgatggacgacgacgatatggagtatctgttgcggtacgat
tcagtccatggacggctgcctggcgtctcccgtgagggaagccgcctctacgccaacggc
cacgaagtgcagttactttccgagcgtgacccgacagaactcccctgggacgaactcgat
atcgatgtcgcgttcgaggcgaccggactgttccggacgcacgatgaggccgcccagcat
ctggatgcaggtgcggacaaggtgatcatctcggctccaccgaaaggcgagaaggacgtt
ccgatgttcgtctacggtgtcaatcacgaggcgtacaacggggaggatgtcctgtcgaac
gcctcgtgtaccacgaactccgtcgcgccggtcttacaggtgctcgacgaggaattcggc
attgtctcaggagtcctcatgaccgtccacgcctacaccgggagccaggggctggtcgac
ggtccaatggataaacgacgccgtgggcgcgcagccgccgagaacatcgtcccgacgacg
accggagcggcgaactccacgatcgagatacttccagggctcgagggcaaactcgacggc
atggcgatgcgtgttccggttcctaacgggtcgatcaccgatatcactgtcaatgtcgag
gccgacattactcgagacgatctcctcgaggccatccgtggcgcagcagataacggtctc
gcgggtgtgttgggctacactgacgacgaaatcgtctccagagatatcgtcgggctcccg
tttgcctcgtacgtcgacctcgagtccgcgatggtcgtcgccaacgacatcgtcaaggtg
cttgcctggtacgacaacgagtacggattctcgacacagatgctggatctcgcacgctac
gtcgcgacagagacggatacgatcgacactacggggactatcactcactga

DBGET integrated database retrieval system