KEGG   Natrialba magadii: Nmag_3794Help
Entry
Nmag_3794         CDS       T01176                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_3794
   01230 Biosynthesis of amino acids
    Nmag_3794
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_3794
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Nmag_3794
Exosome [BR:nmg04147]
 Exosomal proteins
  Proteins found in most exosomes
   Nmag_3794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNMAG01:176722..177792
Genome map
AA seq 356 aa AA seqDB search
MRANTGSDTTSNETLRIGLNGFGRVGRSILRASLTEDAIDVVAVNDVMDDDDMEYLLRYD
SVHGRLPGVSREGSRLYANGHEVQLLSERDPTELPWDELDIDVAFEATGLFRTHDEAAQH
LDAGADKVIISAPPKGEKDVPMFVYGVNHEAYNGEDVLSNASCTTNSVAPVLQVLDEEFG
IVSGVLMTVHAYTGSQGLVDGPMDKRRRGRAAAENIVPTTTGAANSTIEILPGLEGKLDG
MAMRVPVPNGSITDITVNVEADITRDDLLEAIRGAADNGLAGVLGYTDDEIVSRDIVGLP
FASYVDLESAMVVANDIVKVLAWYDNEYGFSTQMLDLARYVATETDTIDTTGTITH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgaacacaggtagtgataccacatcgaacgagacgcttcggatcggactcaat
gggttcggacgagtcggacgaagcattctgcgtgcgtcgctgaccgaggatgcaatcgac
gtcgtcgccgtaaacgacgtgatggacgacgacgatatggagtatctgttgcggtacgat
tcagtccatggacggctgcctggcgtctcccgtgagggaagccgcctctacgccaacggc
cacgaagtgcagttactttccgagcgtgacccgacagaactcccctgggacgaactcgat
atcgatgtcgcgttcgaggcgaccggactgttccggacgcacgatgaggccgcccagcat
ctggatgcaggtgcggacaaggtgatcatctcggctccaccgaaaggcgagaaggacgtt
ccgatgttcgtctacggtgtcaatcacgaggcgtacaacggggaggatgtcctgtcgaac
gcctcgtgtaccacgaactccgtcgcgccggtcttacaggtgctcgacgaggaattcggc
attgtctcaggagtcctcatgaccgtccacgcctacaccgggagccaggggctggtcgac
ggtccaatggataaacgacgccgtgggcgcgcagccgccgagaacatcgtcccgacgacg
accggagcggcgaactccacgatcgagatacttccagggctcgagggcaaactcgacggc
atggcgatgcgtgttccggttcctaacgggtcgatcaccgatatcactgtcaatgtcgag
gccgacattactcgagacgatctcctcgaggccatccgtggcgcagcagataacggtctc
gcgggtgtgttgggctacactgacgacgaaatcgtctccagagatatcgtcgggctcccg
tttgcctcgtacgtcgacctcgagtccgcgatggtcgtcgccaacgacatcgtcaaggtg
cttgcctggtacgacaacgagtacggattctcgacacagatgctggatctcgcacgctac
gtcgcgacagagacggatacgatcgacactacggggactatcactcactga

DBGET integrated database retrieval system