KEGG   Natrialba magadii: Nmag_4015Help
Entry
Nmag_4015         CDS       T01176                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nmg  Natrialba magadii
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nmg00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNMAG02:54975..56453
Genome map
AA seq 492 aa AA seqDB search
MRLEATTIDIGTSRPLVLLNTFDADELGAHPLDRVRIGWEGETTTGIVKRTDELVEPGIV
GVTEPLHHVHGDVGITLAGTPPSVRCVRKKLDDVELGRAELERIVRDVHEHRLSDVELSA
FVSAVYANGLSLAETKHLTEAMSGVGQRLQWDRPVVADKHSIGGVAGNCVTPIMVAIVTE
AGVTMPKTSSRAVTSPAGTADVMEVLSDVEFSIDEIERIVTDTNGCLVWGGGVDLSPVDD
EIIRAENPLSIDPEGLLMASVLSKKQSAGSTNVVIDIPYGEGAKVESLVAARELADDFKR
VGDHLEMDVSCAITHGTDPIGRGIGPVLEARDVLAVLEGNGPDSLRLKSLRLAEMLLEHC
GVDASATEILDSGKALEQFRTIVAAQGGDPDVESTDLEPGEESTTVRADRAGITSRVDNR
QLSDLARRAGAPRDSGAGLVVHRTVGDEVELGDRLYTIHAETESKLEEAVSFADQLEPIR
VRSKADALIERR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcgaggccaccacgatcgacatcggcacatctcgtccgctggtcctgctgaac
acgttcgacgcggacgaactgggtgcacatccgctcgaccgcgtccggatcgggtgggag
ggggagacgaccaccgggatcgtcaagcggaccgacgaactggtcgagccgggcatcgtc
ggcgtgaccgaacccctccaccacgtacacggtgacgtcgggatcacgctcgcggggacg
ccgccgtcggtccggtgcgttcggaagaaactggacgacgtcgaacttgggcgggcggaa
ctcgagcggatcgtccgggacgtccacgaacaccggctctcggacgtcgagttgagcgcg
ttcgtctccgcggtctacgcgaacgggctctcgctggccgagacgaagcacctgaccgag
gcgatgagcggcgttggccagcgactgcagtgggatcgcccggtcgtcgcggacaaacac
tccatcgggggcgtggcgggcaactgcgtgacgccgatcatggtcgcgatcgtcaccgaa
gccggcgtgacgatgcccaagacctcctcgcgggcggtaacctcgccggccggcactgcg
gacgtgatggaggtcctcagtgatgtcgagttctcgatcgacgagatcgaacggatagtc
accgacaccaacggctgtctcgtctggggtggcggtgttgatctctcgcccgtcgacgac
gagatcatccgtgcggagaacccgctatcgatcgatcccgagggactgctgatggcgtca
gtgctctcgaaaaaacagagcgccggctcgaccaacgtcgtgatcgatatcccctacggc
gagggggcgaaagtcgagagcctggttgctgcccgcgaactcgcggacgatttcaagcgc
gtcggcgaccacctggagatggatgtcagctgtgcgatcacccacgggaccgatccgatc
ggccgtggcatcggtcccgtcctcgaggcccgtgacgtcctcgcggtgctcgagggtaac
ggcccggattcgctccggctgaagtcgttgcggctcgccgagatgttactcgagcactgt
ggtgtcgacgcctctgcgaccgaaattctcgactccggcaaggcactcgagcagttccgg
acgatcgttgccgcacaggggggcgatccggacgtcgaatcgacggatctcgagcccggc
gaggagtcgacgaccgtccgggcagatcgggccgggatcacgagtcgcgtcgacaacagg
cagctgtctgacctcgcacggcgtgccggcgcaccgcgtgacagcggggccggactcgtc
gtccaccgaacggttggcgacgaggtcgaactcggggatcggctgtacacgatccacgcc
gaaaccgagtccaaactcgaggaggcagtgtcgttcgccgaccaactcgagccgatcagg
gttcggagcaaggccgacgcattaatcgaacgacggtag

DBGET integrated database retrieval system