KEGG   Natrialba magadii: Nmag_4032Help
Entry
Nmag_4032         CDS       T01176                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nmg  Natrialba magadii
Pathway
nmg00010  Glycolysis / Gluconeogenesis
nmg00020  Citrate cycle (TCA cycle)
nmg00620  Pyruvate metabolism
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01120  Microbial metabolism in diverse environments
nmg01130  Biosynthesis of antibiotics
nmg01200  Carbon metabolism
Module
nmg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_4032
   00020 Citrate cycle (TCA cycle)
    Nmag_4032
   00620 Pyruvate metabolism
    Nmag_4032
Enzymes [BR:nmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nmag_4032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-ProteinID: ADD07561
UniProt: D3T1V2
Position
pNMAG02:73614..74357
Genome map
AA seq 247 aa AA seqDB search
MTSPTENGDASQNSDTSSGDERTVLEERKLTGMRRTIANRLQESSQEAAHVTASREVDAE
ELVRAAEVASDKYDVDVSVVDIVLCALSETLADHPAFNATLEDGLHRLYETQNVGIAVDI
DAGLVTPVLTALESKSLDQVAIERRELTESVQTGSYSMSDLRGGTFTITNLGVLGIDSFT
PIINPPEVAILGVNRIRDRARPGDEGVDFRKQIQFDLSFDHRVVDGADAARFLETLATHI
ENAEALL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccccaccgaaaacggcgacgctagccagaacagcgacacctcatcgggcgac
gaacgcaccgttctcgaggagcgcaaactcacagggatgcgccgaacgatcgcaaatcgc
ctccaggagagttcgcaagaggccgctcacgtgacggcaagtcgcgaggttgacgccgag
gaactcgtgagagcagccgaggtggcgagcgacaaatacgacgttgacgtctccgtggtt
gatattgtcctctgtgcgctctcggaaacgcttgcggaccaccctgcgttcaacgcaaca
ctcgaggacggccttcaccgcctctacgagacacagaacgttggtatcgcagtcgatatc
gacgctggattggtgacgccagtcctcaccgcactcgagtcgaaatcgctcgatcaagtt
gcgatcgaacgtcgtgagttgacagaatctgtgcagacaggctcctattctatgtctgat
cttcgtggcgggacgttcacgataacgaatcttggcgttctgggtatcgactcgttcacg
ccgatcatcaacccgccagaagtagcgatccttggtgtcaatcgcatccgagaccgtgca
cgcccgggcgacgaaggtgttgactttcgcaaacagattcagtttgatctgagcttcgac
catcgagtcgtcgatggcgccgatgcagctcggttcctcgagacgttggctactcatatt
gagaacgctgaagcactgctgtga

DBGET integrated database retrieval system