KEGG   Natrialba magadii: Nmag_4032Help
Entry
Nmag_4032         CDS       T01176                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:nmg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nmg00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nmg00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nmg00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNMAG02:73614..74357
Genome map
AA seq 247 aa AA seqDB search
MTSPTENGDASQNSDTSSGDERTVLEERKLTGMRRTIANRLQESSQEAAHVTASREVDAE
ELVRAAEVASDKYDVDVSVVDIVLCALSETLADHPAFNATLEDGLHRLYETQNVGIAVDI
DAGLVTPVLTALESKSLDQVAIERRELTESVQTGSYSMSDLRGGTFTITNLGVLGIDSFT
PIINPPEVAILGVNRIRDRARPGDEGVDFRKQIQFDLSFDHRVVDGADAARFLETLATHI
ENAEALL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccccaccgaaaacggcgacgctagccagaacagcgacacctcatcgggcgac
gaacgcaccgttctcgaggagcgcaaactcacagggatgcgccgaacgatcgcaaatcgc
ctccaggagagttcgcaagaggccgctcacgtgacggcaagtcgcgaggttgacgccgag
gaactcgtgagagcagccgaggtggcgagcgacaaatacgacgttgacgtctccgtggtt
gatattgtcctctgtgcgctctcggaaacgcttgcggaccaccctgcgttcaacgcaaca
ctcgaggacggccttcaccgcctctacgagacacagaacgttggtatcgcagtcgatatc
gacgctggattggtgacgccagtcctcaccgcactcgagtcgaaatcgctcgatcaagtt
gcgatcgaacgtcgtgagttgacagaatctgtgcagacaggctcctattctatgtctgat
cttcgtggcgggacgttcacgataacgaatcttggcgttctgggtatcgactcgttcacg
ccgatcatcaacccgccagaagtagcgatccttggtgtcaatcgcatccgagaccgtgca
cgcccgggcgacgaaggtgttgactttcgcaaacagattcagtttgatctgagcttcgac
catcgagtcgtcgatggcgccgatgcagctcggttcctcgagacgttggctactcatatt
gagaacgctgaagcactgctgtga

DBGET integrated database retrieval system