KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0081Help
Entry
NMBH4476_0081     CDS       T01946                                 

Gene name
rfbC2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMBH4476_0081 (rfbC2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBH4476_0081 (rfbC2)
Enzymes [BR:nmh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NMBH4476_0081 (rfbC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90814..91353
Genome map
AA seq 179 aa AA seqDB search
MNIIDTAIPDVKLLEPQVFGDARGFFMETFRDEWFKTQVCERTFVQENHSKSGKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMRKDSPTFGKWVGEILSAENKRQLWVPEGFAHGFY
VLSDEAEFVYKCTDYYNPKAEHSLIWNDPTVGIDWPLQGEPNLSPKDLAGKVLSEAVTF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcattgataccgccattcctgacgtaaaactgcttgagccccaagtcttcggc
gacgcgcgcggcttttttatggaaaccttccgcgacgagtggtttaaaacccaagtctgc
gaacgcaccttcgtgcaggaaaaccactccaaatccggcaaaggcgtattgcgcggcctg
cactatcaaactgaaaacacacaaggcaaactcgtacgcgtggttgtcggcgaagtattc
gacgtggccgtcgatatgcgtaaagactcccccactttcggcaaatgggtaggcgaaatt
ctgtccgcagaaaacaaacgccaactgtgggtacccgaaggtttcgcacacggcttctat
gtactgagcgatgaagccgagttcgtctataaatgcacagactattacaaccccaaagcc
gaacactcgctgatttggaatgatccgaccgtcggcatcgactggccgttgcaaggcgag
ccgaacctgtcgcctaaagacttggcaggcaaagtattgtctgaagcggtaacgttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system