KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0121Help
Entry
NMBH4476_0121     CDS       T01946                                 

Definition
translation elongation factor Tu
Orthology
K02358  
elongation factor Tu
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
132328..133512
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERSKPHVNVGTIGHVDHGKTTLTAALTTILAKKFGGAAKAYDQIDNAPEEKARG
ITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFMNKCDMVDDAELLELVEMEIRDLLSSYDFPGDDCPIVQGSALKALE
GDAAYEEKIFELAAALDSYIPTPERAVDKPFLLPIEDVFSISGRGTVVTGRVERGIIHVG
DEIEIVGLKETQKTTCTGVEMFRKLLDEGQAGDNVGVLLRGTKREDVERGQVLAKPGTIT
PHTKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGAVTLEEGVEMVMPGENVTIT
VELIAPIAMEEGLRFAIREGGRTVGAGVVSSVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaaattcgaacgtagcaaaccgcacgtaaacgttggcaccatcggtcac
gttgaccatggtaaaaccaccctgactgccgctttgactactattttggctaaaaaattc
ggcggtgctgcaaaagcttacgaccaaatcgacaacgcacccgaagaaaaagcacgcggt
attaccattaacacctcgcacgtggaatacgaaaccgaaacccgccactacgcacacgta
gactgcccggggcacgccgactacgttaaaaacatgattaccggcgccgcacaaatggac
ggtgcaatcctggtatgttccgcagccgacggccctatgccgcaaacccgcgaacacatc
ctgctggcccgccaagtaggcgtaccttacatcatcgtgttcatgaacaaatgcgacatg
gtcgacgatgccgagctgttggaactggttgaaatggaaatccgcgacctgctgtccagc
tacgacttccccggcgatgactgcccgattgtacaaggttccgcactgaaagccttggaa
ggcgatgccgcttacgaagaaaaaatcttcgaactggctgccgcattggacagctacatc
ccgactcccgagcgagccgtggacaaaccgttcctgctgcctatcgaagacgtgttctcc
atttccggccgcggtacagtagtaaccggccgtgtagagcgcggtatcatccacgttggt
gacgagattgaaatcgtcggtctgaaagaaacccaaaaaaccacttgtaccggtgttgaa
atgttccgcaaactgctggacgaaggtcaggcgggcgacaacgtaggcgtattgctgcgc
ggtaccaaacgtgaagacgtggaacgcggtcaggtattggctaaaccgggtactatcact
cctcacaccaaattcaaagcagaagtatacgtactgagcaaagaagagggtggtcgtcac
actccgttcttcgccaactaccgtccgcaattctacttccgtaccaccgacgtaaccggc
gcggttactttggaagaaggtgtagaaatggtaatgccgggtgaaaacgtaaccatcacc
gtagaactgattgcgcctatcgctatggaagaaggcctgcgctttgcgattcgcgaaggc
ggccgtaccgtgggtgccggcgtggtttcttctgttatcgcttaa

DBGET integrated database retrieval system