KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0303Help
Entry
NMBH4476_0303     CDS       T01946                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMBH4476_0303
   00670 One carbon pool by folate
    NMBH4476_0303
Enzymes [BR:nmh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NMBH4476_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317048..317536
Genome map
AA seq 162 aa AA seqDB search
MLKITLIAACAENLCIGAGNAMPWHIPEDFAFFKAYTLGKPVIMGRKTWESLPVKPLPGR
RNIVISRQADYCAAGAETAASLEAALALCAGAEEAVIMGGAQIYGQAMPLATDLRITEVD
LSVEGDAFFPAIDRTHWKEAERTERRVSSKGTRYAFVHYLRY
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaataaccctaattgcggcgtgtgcggaaaacctgtgcatcggggcgggcaat
gctatgccttggcacatccccgaagatttcgcatttttcaaagcctataccttgggcaaa
cccgtcattatggggcggaaaacgtgggaatccctgcccgtcaaacccctgcccggacgg
aggaacatcgtcatcagccggcaggcggattattgcgcggcaggcgcggaaacggcggca
agtttggaggcggcattggcattgtgcgcaggcgcggaagaagccgtcattatgggcggc
gcgcagatatacggacaagcgatgccattggcgaccgatttgcggataaccgaagtggat
ttgtctgtggaaggagatgcatttttccccgcaatagaccggacgcattggaaagaagca
gagcggacggaacgccgtgtcagcagcaaaggcacgcgctatgcttttgtgcattatttg
agatattga

DBGET integrated database retrieval system