KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0303Help
Entry
NMBH4476_0303     CDS       T01946                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nmh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:nmh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317048..317536
Genome map
AA seq 162 aa AA seqDB search
MLKITLIAACAENLCIGAGNAMPWHIPEDFAFFKAYTLGKPVIMGRKTWESLPVKPLPGR
RNIVISRQADYCAAGAETAASLEAALALCAGAEEAVIMGGAQIYGQAMPLATDLRITEVD
LSVEGDAFFPAIDRTHWKEAERTERRVSSKGTRYAFVHYLRY
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaataaccctaattgcggcgtgtgcggaaaacctgtgcatcggggcgggcaat
gctatgccttggcacatccccgaagatttcgcatttttcaaagcctataccttgggcaaa
cccgtcattatggggcggaaaacgtgggaatccctgcccgtcaaacccctgcccggacgg
aggaacatcgtcatcagccggcaggcggattattgcgcggcaggcgcggaaacggcggca
agtttggaggcggcattggcattgtgcgcaggcgcggaagaagccgtcattatgggcggc
gcgcagatatacggacaagcgatgccattggcgaccgatttgcggataaccgaagtggat
ttgtctgtggaaggagatgcatttttccccgcaatagaccggacgcattggaaagaagca
gagcggacggaacgccgtgtcagcagcaaaggcacgcgctatgcttttgtgcattatttg
agatattga

DBGET integrated database retrieval system