KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0649Help
Entry
NMBH4476_0649     CDS       T01946                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMBH4476_0649
  Amino acid metabolism
   00340 Histidine metabolism
    NMBH4476_0649
Enzymes [BR:nmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NMBH4476_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(686806..688095)
Genome map
AA seq 429 aa AA seqDB search
MKKLNTQSPDFQAGLKALLAFETAQNPETERIVADICADVQKRGDAALIEYTNKFDQTNA
KSIDDLILTQADLNAAFERIPNDVQTALQTAARRVESYHQRQKMESWSYTDEDGTLLGQQ
ITPLDRVGIYVPGGKAAYPSSVIMNAMPAHVAGVKEIIMVVPTPKGERNDIVLAAAYVAG
VTKVFTVGGAQAVAALAYGTETIPQVDKITGPGNAFVAAAKRRVFGVVGIDMVAGPSEIL
VIADGTTPADWVAMDLFSQAEHDEIAQAILIGTSQAYLDEVEAAMDRLIETMPRRDIIEA
SLGNRGAMILAKDLDEACEIANYISPEHLELSVENPQEWAKKIRHAGAIFMGRYTGESLG
DYCAGPNHVLPTSRTARFSSPLGTYDFQKRSSLIQVSEQGAQKLGETASVLAHGESLTAH
ARAAEFRMK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcaacacccaatcgcccgatttccaagccggactcaaagccctgctggct
tttgaaaccgcgcaaaaccccgaaaccgaacgcatcgtcgccgacatttgcgccgacgtg
caaaagcgcggcgatgcggctttgattgaatacaccaacaaattcgatcagacaaacgct
aaaagcatcgatgatttaatactcacgcaagccgatttgaacgcggcgttcgagcgcatt
ccgaacgacgttcagacggcattgcagaccgccgcccgccgtgtcgaaagctaccaccaa
cgccaaaaaatggaatcgtggagctacaccgatgaagacggcacgctgttgggacaacaa
atcacaccgcttgaccgcgtcggcatttacgtccccggcggcaaggcggcgtatccgagt
tccgtcatcatgaacgccatgcccgcccacgtcgcaggtgtgaaagaaatcatcatggtc
gtgccgacaccaaaaggcgaacgcaacgacatcgtacttgccgccgcatacgtcgccggc
gtaaccaaagtcttcaccgtcggcggcgcgcaggcggttgccgccctcgcctacggcacg
gaaaccatcccccaagtcgataaaatcaccggtccgggcaacgccttcgtcgccgccgcc
aaacgccgcgtgttcggcgtggtcggcatcgacatggtggcggggccgtctgaaatcctg
gtcatcgccgacggcacgacacctgccgattgggtggcgatggatttgttcagccaggcc
gaacacgacgaaattgcccaagccatcctcatcggcacgtcgcaagcgtatctcgacgaa
gtagaagccgctatggaccgcctgatcgaaactatgccgcgccgcgacatcatcgaagcc
tcgctcggcaacaggggcgcgatgatactcgccaaagacttggacgaagcctgcgaaatc
gccaactacatttcccccgaacacttggaactgtcagtcgaaaacccgcaggaatgggcg
aaaaaaatccgccacgccggtgcgattttcatgggacgctacaccggcgaaagcctcggc
gactactgcgccggtccaaaccatgtgttgcccaccagccgaaccgcccgcttttcctcg
cctttggggacatatgatttccaaaaacgctccagcctgattcaggtttcggaacagggc
gcgcaaaaattaggcgaaaccgccagcgtgctggcacacggcgaaagcctgaccgcccac
gcccgcgcggcagagttccgtatgaaataa

DBGET integrated database retrieval system