KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0828Help
Entry
NMBH4476_0828     CDS       T01946                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00010  Glycolysis / Gluconeogenesis
nmh00052  Galactose metabolism
nmh00500  Starch and sucrose metabolism
nmh00520  Amino sugar and nucleotide sugar metabolism
nmh00521  Streptomycin biosynthesis
nmh01100  Metabolic pathways
nmh01110  Biosynthesis of secondary metabolites
nmh01120  Microbial metabolism in diverse environments
nmh01130  Biosynthesis of antibiotics
nmh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBH4476_0828 (glk)
   00052 Galactose metabolism
    NMBH4476_0828 (glk)
   00500 Starch and sucrose metabolism
    NMBH4476_0828 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NMBH4476_0828 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBH4476_0828 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NMBH4476_0828 (glk)
Enzymes [BR:nmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NMBH4476_0828 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADY95446
UniProt: E6MZG8
Position
913070..914056
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKQAGYPRLVADIGGTNARFALETAPRVIEKAAVLPCKDYDTVTDAVRAYLNQSG
ATAVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQTLGLDTLILLNDFTAQALAVTQTS
SKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSHAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYGHVSAERFLSGAGLSLVYEALAAKQKAKPAKLMPSEITEKALSGTSPLCRQ
TLDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRVLEYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGISGAAAALDNHLRNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacaagccggatatccccgactggtcgccgatatcggcggg
acgaatgcacgctttgcgctggaaaccgcgccgcgcgtcattgaaaaagccgccgtgctt
ccgtgtaaagactacgatacggttaccgatgcggtgcgtgcctatctgaatcaaagcggt
gcaacagccgtacggcacgcggcatttgccatcgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcagactttggggctg
gacaccctcatccttttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcaggtaggcgggcaaaagcctgtcgaatttgcccccaaagccgtt
atcggccccggtaccggcctgggcgtgagcggattggtgcacagccacgcaggctgggtg
gctttggcgggcgagggcgggcataccagtttcccgccgtttgacgatatggaagtgctg
atttggcagtacgccaaaaacaaatacggccatgtttccgccgaacgctttttgagcggc
gcgggcttgagcttggtttacgaggctttggctgcaaaacagaaagccaaacccgccaaa
ctgatgccgtctgaaatcacggaaaaggctttgagcggcacgtcgcctttgtgccgtcag
actttggacatcttctgcgccatgctcggcacggttgcttccaacctcgccctgacgctg
ggcgcgcgcggcggcgtgtacctgtgcggcggcattattccccgcgtgttggaatacttc
aaaacttccccgttccgcagccgtttcgagaacaagggcaggtttgaagcatatcttgcc
gcgattcccgtgtatgtcgtcttgagcgagtttcccggaatttccggtgcggctgcggct
cttgacaaccatttgagaaacgtttaa

DBGET integrated database retrieval system