KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0876Help
Entry
NMBH4476_0876     CDS       T01946                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00010  Glycolysis / Gluconeogenesis
nmh00020  Citrate cycle (TCA cycle)
nmh00620  Pyruvate metabolism
nmh01100  Metabolic pathways
nmh01110  Biosynthesis of secondary metabolites
nmh01120  Microbial metabolism in diverse environments
nmh01130  Biosynthesis of antibiotics
nmh01200  Carbon metabolism
Module
nmh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBH4476_0876 (aceF)
   00020 Citrate cycle (TCA cycle)
    NMBH4476_0876 (aceF)
   00620 Pyruvate metabolism
    NMBH4476_0876 (aceF)
Enzymes [BR:nmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NMBH4476_0876 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Methyltr_RsmB-F FAP
Motif
Other DBs
NCBI-ProteinID: ADY95491
Position
complement(967981..969588)
Genome map
AA seq 535 aa AA seqDB search
MSIVEIKVPDIGGHENVDIIAVEVKAGDTIAVDDTLITLETDKATMDVPADAAGVVKEVK
VKVGDKISEGGVILTVETGAAAAEAAPAAAEAQPAPAAAPAAAGGATVQVAVPDIGGHTD
VDVIAVEIKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAVFLKVGDKVSEGSAIIEV
ETVGSAAAAPAQAAQAAAPAAAPPPTAAAAPAAAPAPSAPAAAKIDEAAFAKAHAGPSAR
KLARELGVDLGQVKGTGLKGRIMGDDIKAFVKSVMQGGAAKPAAASASLGGGLDLLPWPK
VDFSKFGNVEVKELSRIKKISGQNLSRNWVVIPHVTVHEEADMTELEEFRKQLNKEWERE
GVKLSPLAFIIKASVSALKAFPEFNASLDGDNLVLKNYFNIGFAADTPNGLVVPVIKDVD
QKGLKQISQELTELSKKAREGKLKPQEMQGACFTISSLGGIGGTGFTPIVNAPEVAILGV
CKSQIKPVWNGKEFAPRLMCPLSLSFDHRVIDGAAGMRFTVFLAKLLKDFRRITL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtagaaatcaaagtccccgatatcggcggtcacgaaaacgtcgacatcatc
gccgtagaagttaaagcgggcgacaccatcgccgttgacgacaccctgattacactggaa
accgacaaagccacgatggatgtgcctgccgatgcggccggtgtcgtgaaagaagtaaaa
gtcaaagtcggcgacaaaatctccgaaggcggcgtaattctgaccgttgaaaccggtgcc
gccgccgccgaagccgccccggctgctgccgaagcacaacctgcacctgctgccgcaccc
gctgccgcaggcggtgcaaccgttcaagtagccgttcccgatatcggcggccataccgat
gtggatgtaatcgccgttgaaatcaaagtgggcgacaccgttgccgaagacgacacgctg
attactttggaaaccgataaagcgacaatggacgtaccttgtaccgctgccggtgtcgtt
aaagccgtattcttaaaagtcggcgacaaagtatccgaaggctctgccattatcgaagta
gaaaccgtcggctctgccgcagcagcccctgctcaagccgctcaagctgccgcaccggct
gccgctccgcctccgactgctgccgccgcacccgccgccgcgcctgcaccttctgcacct
gccgctgccaaaatcgacgaggccgctttcgccaaagcacacgccggtccttccgcacgc
aaactggcgcgcgaattgggcgtggatttgggccaagtcaaaggcaccggcttgaaaggc
cgtatcatgggcgacgacatcaaagcctttgtgaaatccgtgatgcagggcggcgcggca
aaacctgccgcagccagcgcatctttgggcggcggtctggacttactgccgtggcctaaa
gtggacttctccaaattcggcaatgtcgaagttaaagaattgtcccgcattaagaaaatt
tccggtcaaaacctgtcccgcaactgggttgtgattccccacgttaccgtacacgaagaa
gcggacatgaccgagctggaagaattccgcaaacagctgaacaaagaatgggaacgcgaa
ggcgtgaaactgtccccgttggcgttcatcatcaaagcctctgtttccgcgttgaaagca
ttccccgaattcaacgcctcactggacggcgacaacctggtgctgaaaaactacttcaac
atcggtttcgcagccgatacgccgaacggcttggttgttcccgtcatcaaagacgtggat
caaaaaggcttgaaacaaatcagccaagaattgaccgaattgtccaaaaaagcccgtgaa
ggcaagctcaaaccgcaagaaatgcaaggcgcgtgctttaccatttccagcttaggcggc
atcggcggcacaggcttcacgccaattgtgaacgctcccgaagtcgccatcttgggcgtg
tgcaaatcccaaatcaaacctgtttggaacggcaaagagtttgccccgcgcctgatgtgc
ccgttgagcctgtccttcgaccaccgtgtcatcgacggtgcggccggtatgcgcttcacc
gtattcttggcgaagctgttgaaagacttccgccgcattaccttataa

DBGET integrated database retrieval system