KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0976Help
Entry
NMBH4476_0976     CDS       T01946                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMBH4476_0976 (recR)
DNA repair and recombination proteins [BR:nmh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMBH4476_0976 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087405..1088022
Genome map
AA seq 205 aa AA seqDB search
MSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVYHCA
MCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGMD
VSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLGG
ELEYVDAGTLAQAVYERRLIKEGGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggttttaccc
aacgtcgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgcaaa
gaggctgaaaaactggtggatgccttgcagacggcattgaagcaggtttaccattgcgcg
atgtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgcgac
gggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggcaaac
tgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatggac
gtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaagaa
atcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtccgag
ttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcattcccttgggcggc
gaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctgatt
aaagaaggcggggcataa

DBGET integrated database retrieval system