KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1217Help
Entry
NMBH4476_1217     CDS       T01946                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase succinyl-transferring complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nmh01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nmh00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:nmh00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327926..1329107)
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARVDTAATAAAEAPAAAPAEAAPAAAPAATQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAGAAAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgttgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagccgttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gctcaagacggtgaaaccgttgttgccgaccaagttttggcgcgcgtcgatacagctgct
actgccgctgctgaagccccagccgccgctcctgcagaagctgccccagctgccgctcct
gctgctacacaaaacaacgccgctatgcctgctgccgccaaactggctgccgagaccggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccggagccgctgctcctgctgttgcacttcctgccggc
gcacgtcctgaagaacgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgcctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaacca
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaactg
ggctttatgtccttcttcgttaaagccgctgttgccgccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacatcgtgtaccacggctacttcgacatcggtatcgca
attggcagcccacgcggtttggttgtgccaattctgcgtgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtctaccccgatcatcaacccacctcaatctgcgattttgggtatgcacgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccgatgatgtatctggctctg
tcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccggcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system