KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1217Help
Entry
NMBH4476_1217     CDS       T01946                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase succinyl-transferring complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBH4476_1217 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBH4476_1217 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NMBH4476_1217 (sucB)
Enzymes [BR:nmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMBH4476_1217 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327926..1329107)
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARVDTAATAAAEAPAAAPAEAAPAAAPAATQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAGAAAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgttgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagccgttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gctcaagacggtgaaaccgttgttgccgaccaagttttggcgcgcgtcgatacagctgct
actgccgctgctgaagccccagccgccgctcctgcagaagctgccccagctgccgctcct
gctgctacacaaaacaacgccgctatgcctgctgccgccaaactggctgccgagaccggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccggagccgctgctcctgctgttgcacttcctgccggc
gcacgtcctgaagaacgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgcctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaacca
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaactg
ggctttatgtccttcttcgttaaagccgctgttgccgccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacatcgtgtaccacggctacttcgacatcggtatcgca
attggcagcccacgcggtttggttgtgccaattctgcgtgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtctaccccgatcatcaacccacctcaatctgcgattttgggtatgcacgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccgatgatgtatctggctctg
tcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccggcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system