KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1223Help
Entry
NMBH4476_1223     CDS       T01946                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00020  Citrate cycle (TCA cycle)
nmh00190  Oxidative phosphorylation
nmh00650  Butanoate metabolism
nmh01100  Metabolic pathways
nmh01110  Biosynthesis of secondary metabolites
nmh01120  Microbial metabolism in diverse environments
nmh01130  Biosynthesis of antibiotics
nmh01200  Carbon metabolism
Module
nmh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBH4476_1223 (sdhD)
   00650 Butanoate metabolism
    NMBH4476_1223 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMBH4476_1223 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ADY95821
UniProt: E6MVX6
Position
complement(1336480..1336821)
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggcgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctg
gtcggctgcttggtgtattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system