KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1407Help
Entry
NMBH4476_1407     CDS       T01946                                 

Definition
(RefSeq) uroporphyrinogen-III synthase (EC:4.2.1.75)
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMBH4476_1407
Enzymes [BR:nmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NMBH4476_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1500472..1501212)
Genome map
AA seq 246 aa AA seqDB search
MLIVRPSGRAAEDVETCLNAGWRAEVLSPVEIEADAAGLELLSEQYARADAVFWVSPTAV
ETAVPYLNLSDGIKAQIAVGQGSRRALERCLVRTVIAPDDGNDSEAVLRLPVWNSLPEGA
RVLFVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHKPLNFQNFQTENIAAAYITSTELVR
LLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSHSSISVSDGMV
FPGTSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgtccgtccgtcgggcagggccgcagaagatgtcgaaacttgcctgaatgcc
ggttggcgcgcggaagtattgagtccggtcgaaatcgaagcagatgctgccggactggaa
cttttgtccgaacaatatgcccgtgcggatgccgtgttttgggtcagtccgaccgccgtt
gaaaccgccgtcccgtaccttaacctttcagacggcataaaggcgcagattgccgtaggg
cagggcagccgccgcgcattggaacgctgtttggtcagaacggtcatcgcgcctgatgac
ggcaacgacagcgaggcggttttgcgcctgccggtttggaacagtctgcccgaaggtgcg
cgcgtattgtttgtgcgcggacacggcgggcgggattttttgatgaatgccttgcaggag
aaaggttttcggacggaggtggcagaagtctatttcagacggcataaacctttgaacttt
caaaatttccaaaccgaaaatattgccgccgcctatattacgtcgaccgagctggtgcgc
ttgctgttcgggcagcttccgccgcaattttcccgattcttcaaatccttgctatacttt
acccatcatccgcgcattgcggaggcattgaagcgcgaaggcgtgtgttcggtcgaaacc
gtccctacgctggaagccgcgctttcccattcttccatttccgtttcagacggcatggtc
tttcccggaacctcaaattaa

DBGET integrated database retrieval system