KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1437Help
Entry
NMBH4476_1437     CDS       T01946                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMBH4476_1437 (folK)
Enzymes [BR:nmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NMBH4476_1437 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1525902..1526396
Genome map
AA seq 164 aa AA seqDB search
MNNRHFAVIALGSNLENPAQQVRAALDTLSSHPDIRLKQASSLYMTAPVGYDNQPDFVNA
VCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDFDGISSDDTRLTLPHPR
AHERSFVIRPLAEILPDFVLGKHGKVAELSKRLGNQGIRLLPDR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagacattttgccgtcatcgccctgggcagtaatcttgaaaaccctgcccaa
caggtacgcgccgcattggacacgctgtcgtcccatcctgacatccgtcttaaacaggct
tcctcactgtatatgaccgcgcccgtcggttacgacaatcagcccgattttgtcaatgcc
gtctgcaccgtttccaccactctggacggcattgccctgcttgccgaactcaaccgtatc
gaggctgatttcggacgcgaacgcagcttccgcaacgcgccgcgcacattggatttggac
attatcgactttgacggcatctccagcgacgacacccgactcaccctgccgcatccgcgc
gcgcacgaacgcagtttcgtcatccgccctttggcagaaatcctccctgattttgtttta
ggaaaacacggaaaggttgccgaattgtcaaaacggctgggcaatcaaggtatccgtctt
ttaccggacaggtaa

DBGET integrated database retrieval system