KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1644Help
Entry
NMBH4476_1644     CDS       T01946                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family (EC:1.-.-.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NMBH4476_1644
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBH4476_1644
  Lipid metabolism
   00071 Fatty acid degradation
    NMBH4476_1644
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMBH4476_1644
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMBH4476_1644
   00626 Naphthalene degradation
    NMBH4476_1644
Enzymes [BR:nmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMBH4476_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1733413..1734453
Genome map
AA seq 346 aa AA seqDB search
MQAVVVNKNVAGDVEVIEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVLGH
EGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGGMA
THCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSGVRPGQWIAIYGAGGLGNLGV
QYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVS
AAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaagtaatcgaacgcgag
gttcgcccgttggaatacggcgaggcattggtcgaagtcgaatattgcggcgtgtgccac
accgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgttgggacac
gaaggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtcggcgac
cgcgtcagcatcgcttggctgttccaaagctgcggctcttgcgaatactgcaataccggc
cgcgaaaccctgtgccgttccgtattgaacgcgggctacaccgccgacggcggtatggcg
acccactgtatcgtgagtgccgattacgcggtcaaagtccctgaaggtttggatcctgcg
caagcttccagcattacttgtgccggtgtaaccacttataaagccattaaagtttccggc
gttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttgggggtc
caatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgacgacaaa
ctggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaagacgct
gccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgccgtatct
gctgccgcattcaactctgccgtgaattgcgtccgcgcgggcggacgtgtggttgccatc
gggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggcatcgaa
gtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattcggcgcg
gaaggtttggttgtgccgaaagtccaactgcgtgctttggatgaagcacccgccattttc
caagaaatgcgcgaaggcaaaatcaccggccgtatggtgatcgatatgaaaaaagaatgc
ggctgcggccatcaccactga

DBGET integrated database retrieval system