KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0245Help
Entry
NMO_0245          CDS       T00954                                 

Definition
myo-inositol-1(or 4)-monophosphatase (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:nmi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261482..262276
Genome map
AA seq 264 aa AA seqDB search
MLHRLQKVVRHIAQTEIMPRFLNTPSHRKEDGSMLSEADIAAQTAFAAALPLLIDSPMLG
EEMSRQEQSALWEQYSGEKGLWIVDPIDGTNNFVNGLPHFAVSVAFVRNGRAELGVIYNP
VSGECFYAERGQGAFLNGTRLPLRLVDKKLNEAIAGVEIKYLRSGKLSSRMSTLAPFGTI
RSMGSSTLDWCYLACGRYDVYVHGGQKLWDYAAGALIFEEAGGRLTTLEGDGFWSGEHVF
KRSVVAALEPKLFERWVGWIRENQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaccgtttgcagaaagtcgtgcgccatatcgcgcaaaccgaaattatgccgcgt
tttttgaatacgccgtctcaccgcaaggaagacggttcgatgttgagcgaggcggacatt
gccgcgcagacggcttttgccgccgcgttgccgcttttaatcgacagtccgatgttgggc
gaggaaatgtcgcgacaggaacagtcggctctgtgggaacaatattcgggggaaaagggg
ctgtggattgtcgatccgatagacgggacgaacaattttgtcaacgggctgccgcatttt
gccgtgtcggtggcgtttgtccgcaacgggcgcgccgaattgggtgtgatttacaatccg
gtcagcggcgaatgtttttatgccgaacgggggcagggtgcgtttcttaatggaacccgc
ctgcctttgcgtctcgtggataaaaaactcaatgaggcgattgcgggcgtggaaatcaaa
tatttgcgttcgggcaaactttccagccgtatgagtacgctcgcgccttttggaacgata
cggagtatgggcagcagtacgttggattggtgttatctggcgtgcgggcgttatgatgtt
tatgtccacggcgggcagaagctgtgggattatgccgccggtgcgctgatttttgaggag
gcgggcggcaggctgacgactttggaaggcgacgggttttggagtggtgaacacgtgttc
aaacgctcggtcgttgccgcgctcgaaccgaagctgtttgaacgctgggtcgggtggata
cgggaaaaccaatag

DBGET integrated database retrieval system