KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0281Help
Entry
NMO_0281          CDS       T00954                                 

Gene name
tpi
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00010  Glycolysis / Gluconeogenesis
nmi00051  Fructose and mannose metabolism
nmi00562  Inositol phosphate metabolism
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01120  Microbial metabolism in diverse environments
nmi01130  Biosynthesis of antibiotics
nmi01200  Carbon metabolism
nmi01230  Biosynthesis of amino acids
Module
nmi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMO_0281 (tpi)
   00051 Fructose and mannose metabolism
    NMO_0281 (tpi)
   00562 Inositol phosphate metabolism
    NMO_0281 (tpi)
Enzymes [BR:nmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMO_0281 (tpi)
Exosome [BR:nmi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMO_0281 (tpi)
  Exosomal proteins of bladder cancer cells
   NMO_0281 (tpi)
  Exosomal proteins of melanoma cells
   NMO_0281 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBA03836
UniProt: C6S528
Position
complement(297132..297905)
Genome map
AA seq 257 aa AA seqDB search
MYHQIGMWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccagaacaacaattcgctcatgcaccgcttccgcatcctccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgtcttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccgac
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttccatcctg
caagggctggataccaaaaacatcgccgtcgcctacgaacccgtctgggcgatcggcacc
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system