KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0283Help
Entry
NMO_0283          CDS       T00954                                 

Gene name
pcm
Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Brite
Enzymes [BR:nmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NMO_0283 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD CMAS Methyltransf_11 Methyltransf_18 Methyltransf_12 Ubie_methyltran Methyltransf_23 Methyltr_RsmB-F MTS Methyltransf_9 Methyltransf_3 Methyltransf_24 Methyltransf_32 DUF938
Motif
Other DBs
NCBI-ProteinID: CBA03840
UniProt: C6S530
Position
298695..299351
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGLAYADMELPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVSDDIDAEQQNRAKAVLD
GLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNIVPDVLKQQLKDGGRMVVIVGRKPVQ
RALLITRKGDVFEEKVLFDTLVAHLDDKDTDPFGGFDF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccttgggatgta
ttggattttgacgttttggacgctttggcggagattccgcgcgagctttttgtcgatgag
gacttgcagggtttggcgtatgcggatatggagctgccgcttgccaacggtcataagatg
ctcgagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgaccgcgctgttggcaaaattggctggt
cgtgtggtgtcggacgacatcgatgccgaacagcaaaaccgcgccaaagcggtgttggac
ggcttgggtttggacaatatcgattatgtgcaaaacaacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttacgtcggcggtgcggtcaatattgtgcctgatgtgttg
aaacaacagttgaaagatggcggacgcatggtggttatcgtaggccgcaagcctgttcag
cgcgcgcttttgattacgcgcaagggcgatgtgtttgaagagaaggtgctgttcgatacc
ttggtggcgcatttggacgataaggataccgatccgtttggcggtttcgatttttaa

DBGET integrated database retrieval system