KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0432Help
Entry
NMO_0432          CDS       T00954                                 

Gene name
dsbG
Definition
Protein-disulfide isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Brite
Enzymes [BR:nmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NMO_0432 (dsbG)
Secretion system [BR:nmi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NMO_0432 (dsbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(471054..471836)
Genome map
AA seq 260 aa AA seqDB search
MKTKLIKILTPFTVLPLLACGQTPVSNANAEPAAKAESAGKSVAASLKARLEKTYSAQDL
KVLSVSETPVKGIYEVVVSGRQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDF
ASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDA
ARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
RSQSGYSPMPQLEEIIRKNQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaatcaaaatcttgaccccctttaccgtcctcccgctgctggcttgc
gggcaaacgcccgtttccaatgccaacgccgaacccgccgccaaagccgagtccgccggc
aaatccgttgccgcctctttgaaagcgcgtttggaaaaaacctattccgcccaagatttg
aaagtgttgagcgttagcgaaacaccggtcaaaggcatttacgaagtcgtcgtcagcggc
agacagattatctacaccgatgccgaaggcggctatatgttcgtcggcgaactcatcaac
atcgacacgcgcaaaaacctgaccgaagaacgcgccgccgatttgaacaaaatcgacttc
gcctccctgcctttggacaaagccatcaaagaagtgcgcggcaacggcaagctgaaagtc
gccgtcttctccgaccccgattgtccgttctgcaaacgcttggaacacgagtttgaaaaa
atgaccgacgtgacggtttacagctttatgatgcccattgccggcctgcaccccgatgcc
gcgcgcaaggcgcaaatcttatggtgtcagcccgaccgcgccaaagcgtggacggattgg
atgcgtaaaggcaaattcccggtcggcggcagcatctgcgacaatcccgtcgcggaaacc
acttccttgggcgaacaattcggcttcaacggcacgccgaccctcgtcttccccaacggg
cgcagccaaagcggctacagcccgatgccccaactggaggaaatcatccgcaaaaatcaa
taa

DBGET integrated database retrieval system