KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0524Help
Entry
NMO_0524          CDS       T00954                                 

Gene name
galU
Definition
putative UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nmi00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nmi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nmi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nmi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(571255..572124)
Genome map
AA seq 289 aa AA seqDB search
MKPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMVEVYERSGNSILGVETVEPSQTGSYGIVETEHLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatacggaaagccgttttccccgtcgcagggatgggaacacgcttcctgccc
gccaccaaggcaagcccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccggacgcaac
aaacgcagcatcgaagaccatttcgacaaggcatacgaactcgaaaccgagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgtcaggcggaagcactgggcttgggacacgccgtcttgtgcgcccgcgcc
gccatcggagacgaaccctttgccgttatccttgccgacgacctgattgatgcccccaaa
ggcgcgctcaaacaaatggtcgaagtgtacgaacgcagcggcaacagcattttgggcgta
gaaactgtcgaaccgtcgcaaaccggctcatacggcatcgtcgaaaccgaacatctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgtcgtcggacgctacatccttaccccgcgcattttcgacttactgaccggactg
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcctggcgcacccctttgaaggcacgcgctacgactgcggcagcaaactgggc
tatctggaagccaccgtcgcctacggcctgaaacaccccgaaaccggcgaacccttccgc
cgccttttggaaaaataccgtaccgaataa

DBGET integrated database retrieval system