KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0564Help
Entry
NMO_0564          CDS       T00954                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00260  Glycine, serine and threonine metabolism
nmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01130  Biosynthesis of antibiotics
nmi01230  Biosynthesis of amino acids
Module
nmi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMO_0564 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMO_0564 (trpA)
Enzymes [BR:nmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMO_0564 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Peripla_BP_6 Pterin_bind ZnuA
Motif
Other DBs
NCBI-ProteinID: CBA04635
UniProt: C6S5U4
Position
605431..606216
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYITVGDPDIRTTLAIMHSMVANGADILELGVPFSDPMADGS
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAG
VDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVADAVIVGSRIVKEIEN
NTGNEAAAVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccctat
attacggtgggcgaccccgatattcggacaactttggcaataatgcacagtatggttgca
aatggtgcggatattttagagttgggtgtgcctttttccgacccgatggcagacgggtcg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaaccctgtacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggt
gtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccgctctatcgcgag
ctgaaggataacggggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcatcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagtgcacgcaaa
atcggccgggttgccgacgcagttattgtcggcagccggattgtgaaagaaatcgaaaac
aatacaggcaacgaggctgccgccgtcggtgctttggtaaaagagttgaaggatgccgtg
cgctga

DBGET integrated database retrieval system