KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0591Help
Entry
NMO_0591          CDS       T00954                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMO_0591 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMO_0591 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMO_0591 (trpB)
Enzymes [BR:nmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMO_0591 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635061..636263
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGFFGEHGGLFVSETLIPALQELADAYKAAKNDPSFWEEFHRDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVDSGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKEQMLEAIGRQPDVAVACVGGGS
NAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTAAKDEEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactaccacgcgcccgacgagaagggctttttcggcgaacacggcgggctgttc
gtgtccgagaccctgattcccgctttgcaagagctggcggatgcctataaggcagcgaaa
aacgacccgtcgttttgggaagaattccaccgcgatttgaaacattatgtcggcaggccc
agccccgtttaccacgccgcgcggttgtccgagcatttgggcggtgcgcaaatctggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ctgttggcaaaacgtatgggtaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcgagtgccaccgttgccgcccgcttcggcatgacttgcgacgtgtacatgggt
gcggacgacatccaacgccaaatgcccaacgtgttccgtatgaaattattgggcgcgaat
gtcgtcggcgttgacagcggcagccgtactttgaaagacgcgatgaacgaagccatgcgc
gaatgggtcgcccgcgtggatgacacattctacatcatcggtaccgccgccggccccgcg
ccgtatcccgaaatggtgcgcgactttcaatgcgtgatcggcaatgaagccaaagaacaa
atgttggaagccatcggcagacagcccgacgttgccgttgcctgcgtgggcggcggatcg
aacgccatcggtttgttccacccgtatatcggcgaagaaaacgtgcgcctcgtcggcgtg
gaggccggcggtttgggcgtgaacactcctgatcacgccgcgccgattacttcgggcgca
ccgattggcgtactgcacggtttccgcagctatctgatgcaggacgaaaacggtcaggtt
ttgggtacgcactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacaccgccgccaaagacgaagaagcactcgaa
gcctttgatttgctctgccgcttcgagggaatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaacgcgccgaaaatgggtaaagaccaagtgattctggtcaac
ctctcaggtcgtggcgacaaagacatcaataccgtcgcgaagctcaaagggattaaactg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system