KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0666Help
Entry
NMO_0666          CDS       T00954                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nmi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
713109..713870
Genome map
AA seq 253 aa AA seqDB search
METAKPIMLIVRPSGRAKDDVETCRRAGWQAEVLSPIEIEADAAGLELLSEQYARADAVF
WVSPTAVETAVPYLNLSDGIKIHIAVGQGSRRALERYLGRTVIAPHDGNDSEAVLRLPVW
NSLPEGARVLFVRGHGGRDFLMNALQEKGFRTEMAEVYFRRHKPLNFQNFQTENIAAAYI
TSTELVRLLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSHSSI
SVSDGMVFPGTSN
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagcgaaacccatcatgctgattgtccgaccgtcgggcagggcgaaggacgat
gtggaaacctgccgtcgtgccggatggcaggcggaagtgttgagcccgattgaaatcgaa
gcagatgctgccggactggaacttttgtccgaacaatatgcccgtgcggatgccgtgttt
tgggtcagtccgaccgccgttgaaaccgccgtcccgtaccttaacctttcagacggcata
aagatacacattgccgtagggcagggcagccgccgcgcattggaacgctatttgggcaga
acggtcattgcgcctcatgacggaaacgacagcgaggcggttttgcgcctgccggtttgg
aacagtctgcccgaaggtgcacgcgtattgtttgtgcgcggacacggcgggcgggatttt
ctgatgaatgccttgcaggagaaaggttttcggacggagatggcagaagtctatttcaga
cggcataaacctttgaactttcaaaatttccaaaccgaaaatattgccgccgcctatatt
acgtcgaccgagctggtgcgcttgctgttcgggcagcttccgccgcaattttcccgattc
ttcaaatccttgctatactttacccatcatccgcgcattgcggaggcattgaagcgcgaa
ggcgtgtgttcggtcgaaaccgtccctacgctggaagccgcgctttcccattcttccatt
tccgtttcagacggcatggtctttcccggaacctcaaattaa

DBGET integrated database retrieval system