KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0678Help
Entry
NMO_0678          CDS       T00954                                 

Gene name
pgm
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMO_0678 (pgm)
   00030 Pentose phosphate pathway
    NMO_0678 (pgm)
   00051 Fructose and mannose metabolism
    NMO_0678 (pgm)
   00052 Galactose metabolism
    NMO_0678 (pgm)
   00500 Starch and sucrose metabolism
    NMO_0678 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    NMO_0678 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    NMO_0678 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMO_0678 (pgm)
Enzymes [BR:nmi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMO_0678 (pgm)
    5.4.2.8  phosphomannomutase
     NMO_0678 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(727749..729131)
Genome map
AA seq 460 aa AA seqDB search
MASIARDIFKAYDIRGIVGKTLTDEAAYLIGKAIAAKAAEKGMTRIALGRDGRLSGPELM
EHIQRGFTDSGIDVLNVGMVATPMLYFAAINECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLSIIEKDGFAAAGKQGSVTEKDISGEYHNHIVGHVKLKRPMNIAIDAGNGV
GGAFAGKLYRALRCGVTELFCDVDGNFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLSRNPGAKVIFDVKSTRLLAPWIKEHGGEAIM
EKTGHSFIKSTMKKTGALVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatcgcccgcgacatcttcaaagcctacgacatccggggtattgtcggcaaa
accctgaccgacgaagccgcctaccttatcggcaaagccatcgccgccaaagccgccgaa
aaaggcatgacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gagcacatccaacgcggctttaccgacagcggcatcgacgtcctcaacgtcggtatggtc
gccacgcccatgctctattttgccgctatcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcccgattacaatggtttcaaaatgatgctcggcggcgacacg
cttgccggcgaagccatccaagagcttttgtccatcattgaaaaagacggttttgctgcc
gccggcaaacaaggcagcgtaaccgaaaaagacatctccggcgaataccacaaccacatc
gtcggacacgtcaaactcaaacgcccgatgaacatcgctatcgacgcgggcaacggcgtg
ggcggcgcatttgcaggcaaactctaccgcgctttgaggtgcggcgttaccgaacttttc
tgcgacgtggacggcaatttccccaaccaccatcccgacccatccaaacccaaaaacctg
caagatttgattgccgcgctgaaaaacggcgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggcgtggttaccaaagacggcaacattatttatcccgaccgccaa
ctgatgctgttcgcgcaagacgtgttgagccgcaaccccggcgcgaaagtcatcttcgac
gtgaagtccacccgcctgcttgccccgtggattaaagaacacggcggcgaagccataatg
gaaaaaaccggccacagcttcatcaaatcgaccatgaaaaaaaccggcgcactcgtcgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggcttcgacgacggcctg
tacgccggcgcacgcctcttggaaatcctgtccgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcgacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagaagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system