KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0690Help
Entry
NMO_0690          CDS       T00954                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nmi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736980..737981
Genome map
AA seq 333 aa AA seqDB search
MQFPYRNVPASRMRRMRRDDFSRRLMREHTLTADDLIYPVFVLEGSAREEDVPSMPGVKC
QSLDRLLFTAEEASNLGIPMLALFPVVTTNKTECAQEAYNPEGLVPTAVRALRERFPELG
IMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGAQVVAPSDMMDGRIG
AIREALEDAGHIHARIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPANTDEAL
NEVALDIREGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAIANGWLDG
GKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccttaccgcaatgttccggcttcgcgtatgcgccgtatgcgcagggacgat
ttttcacgccgcctgatgcgcgaacacacgctgaccgccgatgatttgatttatccggtg
ttcgtattggaggggtcggcgcgcgaggaggatgtgccttctatgccgggtgtgaagtgt
caaagtttggacaggctgctgtttacggcggaggaagcgtcaaatttgggaatacccatg
ctggcactattccctgtcgttacgacaaataagacagaatgtgcgcaggaggcgtataac
cctgaaggactggtgccgacagccgtccgagccttgcgcgagaggtttcccgaactgggc
attatgacggatgtcgcgctcgatccttatacggtgcacggtcaggacgggctgacggac
gaaaacggttatgtgatgaacgatgaaaccgtagaggttttggtcaagcaggctttgtgc
cacgctgaagcgggcgcacaggtggttgccccttccgatatgatggacgggcgtatcggt
gcgattcgcgaggcgttggaggatgccgggcatatccacgcgcggattatggcgtattcc
gccaaatatgcttcggcgttttacgggccgttccgcgatgcggtgggcagttcgggcaat
ttgggcaaggcggacaagaaaacctaccagatggatccggcaaataccgatgaggcgctg
aatgaagtggcgctcgatattcgggaaggtgcggatatggtgatggtgaagcccggttta
ccgtatttggacgttgtccgccgcgtgaaggacgagttcggcgtaccgacttatgcctat
caggtttcgggagaatacgcgatgttgcaggcagcgattgccaacggctggctggacggc
ggcaaagtggttttggaaagcctgctggcattcaaacgtgcgggtgcggacgggattttg
acctattacgctattgaggcggcaaagatgttgaagcgttga

DBGET integrated database retrieval system