KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0751Help
Entry
NMO_0751          CDS       T00954                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00900  Terpenoid backbone biosynthesis
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMO_0751
Enzymes [BR:nmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NMO_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CBA05185
UniProt: C6S6C6
Position
796487..797332
Genome map
AA seq 281 aa AA seqDB search
MNIADGRQAFPAPAKLNLDLRITGKREDGYHNIESIFCLIDLQDTVYLKPRDDGKIILHN
PVGGIPQEADLSYRAASLLQKYARNPAGVEIWLDKKIPTGAGLGGGSSDAATVLLVLNRW
WQCGLTQRQLIDSGAALGADVPFFIFGKNAFARGIGDRLDEMDIPKQWYVIVKPPVHVST
AKIFTHEGLTRNSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSRYGFALMTGS
GACVFTACQDRDSAYNIYRQVSGLYEAYLAEGLSKHPLLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcggacggacggcaggcgtttcccgcacctgcaaaactgaatctcgatttg
aggattactggaaagcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaaccgagggacgacggcaaaatcatcctgcacaat
cctgtcggcggaataccgcaggaagccgatttgagctaccgtgccgcatcgttgctgcaa
aaatatgcgcgcaaccccgccggcgtggaaatatggctggacaaaaaaatcccgacaggg
gcgggtttgggcggcggaagctcggatgcggcaaccgttttgctggtgttgaaccgttgg
tggcagtgcggtctgacgcagcggcagctcattgattcgggcgcggctctgggggcggac
gtaccgttttttattttcggcaaaaatgcgtttgcgcggggtataggcgacaggctggac
gaaatggatattccgaaacagtggtatgtcatcgtcaaaccgcccgtccacgtttccact
gcaaaaattttcacacacgaaggcttgacacgaaattccgcctcaagcataatgccgact
ttccaaaatctgcaaccgtttagaaatgatatgcaggcagttgtatttaaagaataccct
gaagtttggaaagcctattccgagttgtcccgatatggatttgccttaatgacaggttcc
ggtgcgtgtgtattcacggcgtgtcaagatagggatagcgcatacaatatataccgacaa
gtttcaggtttgtacgaggcatatttggcagagggtctttcaaagcatcctttgttgtcc
gtataa

DBGET integrated database retrieval system