KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0846Help
Entry
NMO_0846          CDS       T00954                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMO_0846 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMO_0846 (sdhD)
   00650 Butanoate metabolism
    NMO_0846 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMO_0846 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884488..884829
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggcgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctg
gtcggctgcttggtgtattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system