KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1050Help
Entry
NMO_1050          CDS       T00954                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMO_1050 (recR)
DNA repair and recombination proteins [BR:nmi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     NMO_1050 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMO_1050 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 Toprim Fusion_gly_K
Motif
Other DBs
NCBI-ProteinID: CBA06030
UniProt: C6S757
Position
complement(1082590..1083210)
Genome map
AA seq 206 aa AA seqDB search
MMSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVYHC
AMCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGM
DVSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLG
GELEYVDAGTLAQAVYERRLIKEGGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggtttta
cccaacgttgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgc
aaagaggctgaaaaactggtggatgccttgcagacggcattgaagcaggtttaccattgc
gcgatgtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgc
gacgggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggca
aactgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatg
gacgtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaa
gaaatcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtcc
gagttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcatccccttgggc
ggcgaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctg
attaaagaaggcggggcgtaa

DBGET integrated database retrieval system