KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1050Help
Entry
NMO_1050          CDS       T00954                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMO_1050 (recR)
DNA repair and recombination proteins [BR:nmi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMO_1050 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1082590..1083210)
Genome map
AA seq 206 aa AA seqDB search
MMSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVYHC
AMCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGM
DVSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLG
GELEYVDAGTLAQAVYERRLIKEGGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggtttta
cccaacgttgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgc
aaagaggctgaaaaactggtggatgccttgcagacggcattgaagcaggtttaccattgc
gcgatgtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgc
gacgggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggca
aactgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatg
gacgtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaa
gaaatcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtcc
gagttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcatccccttgggc
ggcgaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctg
attaaagaaggcggggcgtaa

DBGET integrated database retrieval system