KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1082Help
Entry
NMO_1082          CDS       T00954                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMO_1082 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMO_1082 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMO_1082 (thrC)
Enzymes [BR:nmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMO_1082 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1114286..1115752
Genome map
AA seq 488 aa AA seqDB search
MRQMPSEAVFLQFRQTRKIMKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRE
TLDKWRGLAYPELAFEIMRLFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKI
QALSNGPTLAFKDMAMQFLGNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNV
FMLSPDGKMSAFQRAQMYSLQDENIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVN
SINWGRIVAQVVYYFAGYFNATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPVRRLIVA
TNENDVLDEFFKTGAYRPRNSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEMNTLWA
EVAAGKGFDLRFALEKVGGKYGFTSGKSTHPDRLATIRQVYEQDQELIDPHTADGVKVAR
EVREEGETVVCLETALAAKFDATIREAVGDAAIPRPAALEGLENLPQRVQTVPNSADAVK
GIIEQTLA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatgccgtctgaagccgttttcctgcaatttcgacagacgagaaaaatcatg
aaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattgatg
gggcttgcccccgacggcggcctgatgctgccggaacattatccgcaaatcgggcgcgaa
accttggacaaatggcgcggtttagcttatcccgaattggcgtttgaaattatgcgcctg
tttgttacggatattccggaggacgatttgcgcgacattctgaaccgtacttacacggaa
gcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaaatc
caagccttgtccaacggcccgacgctggcgttcaaagatatggcaatgcagtttttgggc
aatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcaacc
agcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaaaggtgtgaatgta
tttatgctgtcgcccgatggcaaaatgagcgcgttccaacgcgcgcaaatgtacagcctg
caagacgagaatatccacaatatcgccgtgaagggaatgtttgacgactgtcaggatatt
gtgaaggcggtgcagaacgatgccgcgttcaaggaaaaataccatatcggtacggtcaac
tcgatcaactggggacgcatcgtcgcgcaagtggtttattactttgcaggctatttcaac
gccacttcaagcaatgacgaaaccgtcagcttctgcgtaccgagcggcaacttcggcaac
gtttgcgcgggacatattgccaaacagatgggcctgcctgtccgccgcctgattgttgcg
accaatgaaaacgatgtgttggacgagtttttcaaaaccggcgcataccgcccacgcaac
agcgcgcatacttatgttacctccagcccgtctatggacatttccaaagcgtccaacttc
gagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatgaatacgctgtgggcg
gaagtagcggcgggcaaaggctttgacctgcggtttgctttagaaaaagtcggtggcaaa
tacggttttacctccggcaaatccacccaccccgaccgcctcgccaccatcagacaggtt
tatgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcccgc
gaagtgcgcgaagaaggggaaacggttgtgtgtttggaaaccgcgttggcagcgaaattc
gatgcgaccatacgcgaagccgtcggcgatgccgccattccgcgccctgccgcgctggaa
ggtttggaaaacctgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggtaaaa
ggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system