KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1216Help
Entry
NMO_1216          CDS       T00954                                 

Definition
putative type III restriction endonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Brite
Enzymes [BR:nmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     NMO_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1268430..1271210
Genome map
AA seq 926 aa AA seqDB search
MANNKTLFEVIENRKQIYLEDGDSDKFSIPKFITNNLKFPLFDWQKSALENFVIFDRASK
LKDFPDIKNRPTHLLFNMATGAGKTMMMAALILYYFEKGYRHFLFFVNQNNIVDKTENNF
IDPAHAKFLFTEKILQGDTVIPIRKVEMFSPHSDGIEIKFTSIQKLYNDIHTERENQTTL
ADLHKLNLVMLGDEAHHLNAQTKGKKQGELDLEKEINDRTSNAEIERKGWEHMVLELLLN
KNGNPSQNVLLEFTATLPENADVQQKYADKIITKFGLKEFLQKGYTKEINLVSSTLGKKE
RVLHALLFAWYRHQIALKYGIANFKPVMLFRSKTIDESKADYSAFLNWAENVQADDFEFL
DTFSGSLNNSDNANEQGKTRTEQALKFMQENGFEFAHLANWVKQNYQKHNVIITNSETNK
NKTEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWDVLNLFDIVRLYEGQNGGGSNKK
SGKTAAATVSEKQLIGRGVRYFPFAFEGKQPNKRKFDNDMQHELRILEELFYYTHDEQSR
YISELKNELRKDGYLPEKDDDKVLATFKLKSEFADNKDFRELLIWANKKIPNPNAKSNNA
DSLKANPQTLSFQVHGNQLLQETQFTADENDETARQIGTQNNFTQTIKMSEMERHIFNKA
LHIKGKNSQSLFHFNRLQSKLDIQNRNELQNNLLKDWQIEFLGLGQDKQVRLDDKLAGCL
KILEMVEKHLNESDMPFIGTKEFTPKKLWEIFGTPKQKWVKKDDVKTTIATQNDWYVMDN
FAGTSLEEALIQFISARLGDLKSQYDVHLIRNGEVFKLNNFADGEGFMPDFILLLKDKQK
SSSNGVKDFLHYQIFIEPKGEHLVETDGWKEEFLEAITVEYGMDKILQKDTPHYRLIGLP
FFTDHQKNGQFTESFPLGAASLEKIE
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggcgaataataaaactttgtttgaagtaattgaaaaccgcaaacaaatttatttggaa
gacggcgatagcgacaaattttccattcccaaattcattaccaataatttgaaatttccc
ttgtttgattggcaaaaatcggctttagaaaactttgtgatttttgaccgcgcttcaaaa
ttaaaggatttccctgacatcaaaaaccgccctacccatttgctgttcaatatggcaaca
ggtgctggcaaaacgatgatgatggcggcgttgattttgtattattttgaaaaaggttat
cggcattttctgttttttgtgaatcaaaacaatatcgtggataaaacggaaaataatttt
attgacccggcgcacgcaaaatttttatttaccgagaagattttgcagggcgatacggta
attcccattcgcaaagtggaaatgtttagcccacattcagacggcattgaaattaaattt
accagtattcaaaaactgtataacgatatccacaccgaacgggaaaaccaaaccacattg
gcggatttacacaaattgaaccttgtgatgctgggcgatgaagcacaccatttaaacgca
caaaccaaaggcaaaaaacaaggcgaattagatttagaaaaggaaattaacgaccgcact
agcaatgccgagattgaacgcaaaggctgggagcatatggttttggaattgttactcaat
aaaaatggcaatcccagccaaaatgtgctgttggaatttaccgccacgctgcctgaaaat
gctgacgtgcaacaaaaatacgcggataaaatcatcacaaaatttggcttaaaagagttt
ttgcaaaagggttataccaaagaaatcaatttggtatccagtacgctgggcaagaaagag
cgagtattgcacgctttattatttgcttggtatcgccatcaaatcgcgttgaaatacggc
attgccaatttcaagcctgtgatgttgtttagaagtaagacgattgatgaatcaaaagcg
gattattcggcatttttaaattgggcagaaaatgtacaagcggatgattttgagttttta
gatacgttttcaggcagcctgaataatagcgacaacgccaacgaacaaggcaaaacccga
accgaacaagccctaaaatttatgcaggaaaatggctttgagtttgcacatttggcaaat
tgggtgaaacaaaattatcaaaaacataatgtgattattaccaactccgaaaccaacaaa
aacaaaactgaaaaaaccgacagcgaaaccgaaaaattgctaaacaatttggaagcggct
gataatccaatccgtgccatttttacggtagatagattaaccgaaggttgggacgttctg
aatttgtttgatattgtgcgtttgtatgaagggcaaaatggcggtggttcaaataaaaaa
tcaggcaaaacggctgccgctaccgtatcggaaaagcagttgattggtcgtggcgtgcgt
tattttccatttgcgtttgaaggtaaacagccgaataaacgcaaatttgacaacgacatg
caacacgaattgcgtatcttggaagaattgttttattacacgcacgatgagcaatcccgc
tatatttcagaactgaaaaatgagttgcgaaaagacggttatttgcctgaaaaagacgat
gataaggtgttggcaacatttaaactcaaatctgaatttgccgataataaggattttaga
gaattgttaatttgggcgaataaaaaaatccccaacccaaacgccaaaagcaataatgca
gacagcctaaaagccaatccacaaacgctttcattccaagttcacggtaatcaactgttg
caggaaacgcaatttacagccgatgaaaatgatgaaacagcccgacaaatcggcacacaa
aataattttactcaaaccataaaaatgagtgaaatggagcggcacattttcaataaagca
ttacatatcaaagggaaaaatagtcaatctttattccatttcaaccgtttgcaaagcaag
ctcgacattcaaaatcgcaatgaattgcaaaataacttgttgaaagactggcaaattgaa
tttttaggattagggcaagacaaacaggttcgcttggacgataaacttgcaggctgcctg
aaaatcttggaaatggttgaaaaacatctgaatgaaagtgatatgccgtttatcggtaca
aaagaatttacacctaaaaaattatgggaaattttcggcacgccaaaacaaaaatgggtc
aaaaaagatgatgtaaaaacgactattgccacacaaaatgattggtatgtgatggataat
tttgctggaacgagtttggaagaagcgttaattcaatttatttcagcgcgtttgggcgat
ttgaaatctcaatatgacgttcatttaatccgcaatggagaagtatttaaattgaataac
tttgccgatggtgaaggatttatgccggactttattttattgctgaaagataaacaaaaa
tcttcttccaatggcgtgaaggactttttgcattaccaaattttcattgagcccaaaggt
gagcatttagtggaaactgatggatggaaagaagaatttttagaagccatcactgtggaa
tatgggatggataagatcctgcaaaaagatacaccgcattatcgtttgatcggtttaccg
ttttttactgatcatcagaaaaatggacaatttacggagtcattccctttaggtgcggca
tcgcttgaaaaaatagagtag

DBGET integrated database retrieval system