KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1351Help
Entry
NMO_1351          CDS       T00954                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nmi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1434627..1435772)
Genome map
AA seq 381 aa AA seqDB search
MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKA
PVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEH
PDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRR
GSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNING
GTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTHAG
KLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINENVRLDD
IPKLSAVYEGILARLLAGNAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaactcaatccctagagcttgccaaagagctgatttcccgaccatccgttacc
cctgacgacagggattgccaaaaactccttgccgaacgcctgcacaaaatcggttttgcg
gctgaagaactccatttcggcgacaccaaaaacatctggttgcgacgcggcacgaaagcc
cccgtcgtctgttttgcagggcataccgacgttgtgccgacaggccctgtcgaaaaatgg
gattcgcccccgttcgagccggccgagcgcgacggaagattatacgggcgcggtgcggcg
gatatgaaaaccagcatcgcctgttttgttaccgcctgcgaacgctttgttgccgaacac
cccgatcatcaaggcagcatcgcgctcctgattacttccgacgaagagggcgacgcgctg
gacggcacgaccaaagtcgtcgatgtgttgaaagcgcgcggcgagttgattgactactgc
atcgtcggcgaaccgaccgccgtggacaaattgggcgatatgattaaaaacggccggcgc
ggctcgctgtcgggcaacctgaccgtcaaaggcaagcaaggccatattgcctatccgcat
ttggcaatcaatcccgtgcatacttttgccccggccttgttagagctgacgcaggaagtc
tgggacgaaggcaacgaatacttcccgccgaccagtttccagatttccaatatcaacggc
ggcacaggcgcgaccaacgtcattccgggcgagctgagcgtcaaattcaatttccgcttc
tccaccgagtccaccgaagcagggctgaaacaacgcgtccacgccattttggacaaacac
ggtgtgcaatacgatttgcagtggtcgtgttcggggcagcccttcctgacccacgcgggc
aaactgaccgacgtggcacgcgccgccattgccgaaatctgcggcgtagagaccgaattg
tccaccaccggcggcacttcggacggacgcttcatcaaagccattgcaaaagaactcatc
gaattaggcccgtccaatgccaccatccaccaaatcaacgaaaacgtgcggctggacgat
attccgaagctgtctgcggtgtatgaggggatattggcgcgcttgttggctggaaatgcc
gtctga

DBGET integrated database retrieval system