KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1351Help
Entry
NMO_1351          CDS       T00954                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00300  Lysine biosynthesis
nmi01100  Metabolic pathways
nmi01120  Microbial metabolism in diverse environments
nmi01230  Biosynthesis of amino acids
Module
nmi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMO_1351 (dapE)
Enzymes [BR:nmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NMO_1351 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CBA06878
UniProt: C6S7Y7
Structure
PDB: 

Jmol
Position
complement(1434627..1435772)
Genome map
AA seq 381 aa AA seqDB search
MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKA
PVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEH
PDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRR
GSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNING
GTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTHAG
KLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINENVRLDD
IPKLSAVYEGILARLLAGNAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaactcaatccctagagcttgccaaagagctgatttcccgaccatccgttacc
cctgacgacagggattgccaaaaactccttgccgaacgcctgcacaaaatcggttttgcg
gctgaagaactccatttcggcgacaccaaaaacatctggttgcgacgcggcacgaaagcc
cccgtcgtctgttttgcagggcataccgacgttgtgccgacaggccctgtcgaaaaatgg
gattcgcccccgttcgagccggccgagcgcgacggaagattatacgggcgcggtgcggcg
gatatgaaaaccagcatcgcctgttttgttaccgcctgcgaacgctttgttgccgaacac
cccgatcatcaaggcagcatcgcgctcctgattacttccgacgaagagggcgacgcgctg
gacggcacgaccaaagtcgtcgatgtgttgaaagcgcgcggcgagttgattgactactgc
atcgtcggcgaaccgaccgccgtggacaaattgggcgatatgattaaaaacggccggcgc
ggctcgctgtcgggcaacctgaccgtcaaaggcaagcaaggccatattgcctatccgcat
ttggcaatcaatcccgtgcatacttttgccccggccttgttagagctgacgcaggaagtc
tgggacgaaggcaacgaatacttcccgccgaccagtttccagatttccaatatcaacggc
ggcacaggcgcgaccaacgtcattccgggcgagctgagcgtcaaattcaatttccgcttc
tccaccgagtccaccgaagcagggctgaaacaacgcgtccacgccattttggacaaacac
ggtgtgcaatacgatttgcagtggtcgtgttcggggcagcccttcctgacccacgcgggc
aaactgaccgacgtggcacgcgccgccattgccgaaatctgcggcgtagagaccgaattg
tccaccaccggcggcacttcggacggacgcttcatcaaagccattgcaaaagaactcatc
gaattaggcccgtccaatgccaccatccaccaaatcaacgaaaacgtgcggctggacgat
attccgaagctgtctgcggtgtatgaggggatattggcgcgcttgttggctggaaatgcc
gtctga

DBGET integrated database retrieval system