KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1409Help
Entry
NMO_1409          CDS       T00954                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nmi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1500360..1501649
Genome map
AA seq 429 aa AA seqDB search
MKKLNTQSPDFQAGLKALLAFETAQNPETERIVADICADVQKRGDAALIEYTNKFDQTNA
KSIDDLILTQADLKAAFERIPNDVQTALQTAARRVESYHQRQKMESWSYTDEDGTLLGQQ
ITPLDRVGIYVPGGKAAYPSSVIMNAMPAHVAGVKEIIMVVPTPKGERNDIVLAAAYVAG
VTKVFTVGGAQAVAALAYGTETIPQVDKITGPGNAFVAAAKRRVFGVVGIDMVAGPSEIL
VIADGTTPADWVAMDLFSQAEHDEIAQAILIGTSQAYLDEVEAAMDRLIETMPRRDIIEA
SLGNRGAMILAKDLDEACEIANYISPEHLELSVENPQEWAKKIRHAGAIFMGRYTGESLG
DYCAGPNHVLPTSRTARFSSPLGTYDFQKRSSLIQVSEHGAQKLGETASVLAHGESLTAH
ARAAEFRMK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcaacacccaatcgcccgatttccaagccggactcaaagccctgctggct
tttgaaaccgcgcaaaaccccgaaaccgaacgcatcgtcgccgacatttgcgccgacgtg
caaaagcgcggcgatgcggctttgattgaatacaccaacaaattcgatcagacaaacgct
aaaagcatcgatgatttaatacttacgcaagccgatttgaaagcggcgttcgagcgcatt
ccgaacgacgttcagacggcattgcagaccgccgcccgccgtgtcgaaagctaccaccaa
cgccaaaaaatggaatcgtggagctacaccgatgaagacggcacgctgttgggacaacaa
atcacaccgcttgaccgcgtcggcatttacgtccccggcggcaaggcggcgtatccgagt
tccgtcatcatgaacgccatgcccgcccacgtcgcaggtgtgaaagaaatcatcatggtc
gtgccgacaccaaaaggcgaacgcaacgacatcgtacttgccgccgcatacgtcgccggc
gtaaccaaagtcttcaccgtcggcggcgcgcaggcggttgccgccctcgcctacggcacg
gaaaccatcccccaagtcgataaaatcaccggtccgggcaacgccttcgtcgccgccgcc
aaacgccgcgtgttcggcgtggtcggcatcgacatggtggcggggccgtctgaaatcctg
gtcatcgccgacggcacgacacctgccgattgggtggcgatggatttgttcagccaggcc
gaacacgacgaaattgcccaagccatcttaattggcacgtcgcaagcgtatctcgacgaa
gtagaagccgctatggacaggctcatcgaaaccatgccgcgccgcgacatcatcgaagcc
tcgctcggcaacaggggcgcgatgatactcgccaaagacttggacgaagcctgcgaaatc
gccaactacatttcccccgaacacttggaactgtcagtcgaaaatccgcaggaatgggcg
aaaaaaatccgccacgccggtgcgattttcatgggacgctacaccggcgaaagcctcggc
gactactgcgccggcccaaaccatgtgttgcccaccagccgcaccgcccgcttttcctcg
cctttggggacatatgatttccaaaaacgctccagcctgattcaggtttcggaacacggc
gcgcaaaaattaggcgaaaccgccagcgtgctggcacacggcgaaagcctgaccgcccac
gcccgcgcggcagagttccgtatgaaataa

DBGET integrated database retrieval system