KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1450Help
Entry
NMO_1450          CDS       T00954                                 

Gene name
gpxA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NMO_1450 (gpxA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMO_1450 (gpxA)
Enzymes [BR:nmi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NMO_1450 (gpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1545055..1545588)
Genome map
AA seq 177 aa AA seqDB search
MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILD
FPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNH
LFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttacgattttcaaatgaaagatgcagaaggcaatgcggttgatttgtcaggc
tatcgcggcaaggttctgctgatcgtcaacacggcaacgcgttgcggtctgaccccgcaa
tacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagattttggat
tttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcccaagtg
tgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaatggagca
aataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggcaatcat
ctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaaggcgac
atcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgagcgtttt
gcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system