KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1764Help
Entry
NMO_1764          CDS       T00954                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01130  Biosynthesis of antibiotics
nmi01230  Biosynthesis of amino acids
Module
nmi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMO_1764 (trpC)
Enzymes [BR:nmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NMO_1764 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PIG-X
Motif
Other DBs
NCBI-ProteinID: CBA08058
UniProt: C6S926
Position
1907385..1908167
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILTAKAQEVAAQKAAVNAEHIRALAENAPPVRSFIGSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPAEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVSLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEREQLERFEAVAHELGMTVLLELHDESELEKC
RNLTTPLWGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGKADVEFMRARGVHTF
LIGETFMRADDIEAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttaccgccaaggcacaggaagttgccgcccaaaaa
gccgccgtcaacgccgaacacatccgcgcacttgccgaaaacgcaccgcccgtccgcagc
tttatcggttcgatacgcggcaaacaccgcctaaacctgcccgccgtcattgccgaaatc
aaaaaggcaagcccgagcaaaggcctgatccgtccggacttccgacctgccgagattgcc
cgcgcctatgaaaacgccggagcggcgtgtttgtccgtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtatcgctgcccgtcttgcgt
aaagacttcatcatcgacgaatatcaggtttatcaggcgcgcgcctggggggcggatgcc
gtcctgctgattgccgccgcactggaacgggaacaattggaacgctttgaagcggtggcg
cacgaattgggtatgaccgtcctgctcgagctgcacgatgaaagcgaattggaaaaatgc
cgcaacctgaccacgccgttgtggggcgtaaacaaccgcaacctgcggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcccgcgctggaaggcaaaaccgtcgttaccgaa
agcggcattacaggtaaggcggatgtggaatttatgcgggcgcgcggcgtgcacaccttc
ctgatcggcgaaacgtttatgcgtgccgacgatattgaagcagaagtgggcaaactcttc
taa

DBGET integrated database retrieval system