KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1764Help
Entry
NMO_1764          CDS       T00954                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmi01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nmi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1907385..1908167
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILTAKAQEVAAQKAAVNAEHIRALAENAPPVRSFIGSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPAEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVSLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEREQLERFEAVAHELGMTVLLELHDESELEKC
RNLTTPLWGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGKADVEFMRARGVHTF
LIGETFMRADDIEAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttaccgccaaggcacaggaagttgccgcccaaaaa
gccgccgtcaacgccgaacacatccgcgcacttgccgaaaacgcaccgcccgtccgcagc
tttatcggttcgatacgcggcaaacaccgcctaaacctgcccgccgtcattgccgaaatc
aaaaaggcaagcccgagcaaaggcctgatccgtccggacttccgacctgccgagattgcc
cgcgcctatgaaaacgccggagcggcgtgtttgtccgtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtatcgctgcccgtcttgcgt
aaagacttcatcatcgacgaatatcaggtttatcaggcgcgcgcctggggggcggatgcc
gtcctgctgattgccgccgcactggaacgggaacaattggaacgctttgaagcggtggcg
cacgaattgggtatgaccgtcctgctcgagctgcacgatgaaagcgaattggaaaaatgc
cgcaacctgaccacgccgttgtggggcgtaaacaaccgcaacctgcggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcccgcgctggaaggcaaaaccgtcgttaccgaa
agcggcattacaggtaaggcggatgtggaatttatgcgggcgcgcggcgtgcacaccttc
ctgatcggcgaaacgtttatgcgtgccgacgatattgaagcagaagtgggcaaactcttc
taa

DBGET integrated database retrieval system