KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1772Help
Entry
NMO_1772          CDS       T00954                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nmi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1914917..1915501
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKTPPQIVIDVNGVGYEADVSMQTFCNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVSGIGAKTALGILSAMTADELARAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAAAPAADETEDIVGTLLALGYSEREAKAAVKGVPKGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcaggctgaccggcaaactggttgagaaaacccctcctcaaatcgtcatcgat
gtcaacggtgtcggctacgaagccgacgtatcgatgcagaccttctgcaacctgccgccc
gtgggcgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaaaaccttccgccaactgattaaggtcagcggc
atcggcgcgaaaacggctttgggcattttgtcggcgatgacggcagacgagctggcgcgg
gcggtggcggaagaagatgtcaaacgcctctcctccgctccgggaatcggcaaaaaaacc
gccgaacgcatggtcttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgccgcacccgccgccgacgaaacggaagacatcgtcggcacgctcctcgcc
ctcggttacagcgaacgcgaggcaaaagcggcggtcaaaggcgttccgaaagggacggac
gtgggcgaaggcgtgcgccttgctttgaaaaacctgctgaaataa

DBGET integrated database retrieval system