KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1948Help
Entry
NMO_1948          CDS       T00954                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:nmi00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:nmi00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2091337..2091894
Genome map
AA seq 185 aa AA seqDB search
MNIIDTALPDVKILKPQVFTDGRGFFMETFRDGWFKENIADRTFVQENHSKSGKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNQCQLWIPEGFAHGFC
VLGDAAEVVYKCTDYYKPEAEQVLIWNDPTVGIGWPLQTAPLLSPKDLAGKAWAQAEKLR
LTLSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatcgacaccgccctccccgacgtaaaaattttaaaaccgcaagtcttcaca
gacgggcgcggtttttttatggaaaccttccgcgacgggtggttcaaagaaaatattgcc
gaccgaaccttcgtgcaggaaaaccactccaaatccggcaaaggcgtattgcgcggcctg
cactaccaaaccgaaaacacacaaggcaaactcgtacgcgtagttgtcggcgaagtgttc
gacgtggccgtcgatatgcgcgaaggttcgccgactttcggcaaatgggcgggcgcaacc
ctgtccgcgcaaaaccaatgccagctttggatacccgaaggcttcgcgcacgggttttgc
gttttgggcgacgcagcggaagtcgtgtacaaatgcacggactattacaagcctgaagcc
gaacaggttttaatatggaacgacccgacagtcggcataggctggccgcttcaaaccgcg
ccgctgctgtcgcccaaagatcttgccggtaaagcgtgggcgcaagctgaaaagctccgc
cttacgctttcccgataa

DBGET integrated database retrieval system