KEGG   Nakamurella multipartita: Namu_0012Help
Entry
Namu_0012         CDS       T00991                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nml  Nakamurella multipartita
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_0012
   01230 Biosynthesis of amino acids
    Namu_0012
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_0012
   00051 Fructose and mannose metabolism
    Namu_0012
   00562 Inositol phosphate metabolism
    Namu_0012
Enzymes [BR:nml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Namu_0012
Exosome [BR:nml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Namu_0012
  Exosomal proteins of bladder cancer cells
   Namu_0012
  Exosomal proteins of melanoma cells
   Namu_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(14767..15525)
Genome map
AA seq 252 aa AA seqDB search
MARLLIGSSLKMYFGHRQTLDWVRAVAAICTEHPATVSGAVEFFVIPTFPSIPAVVEIAR
PAGIAVGAQDLHWADSGPFTGEVSAAELAELGCTLAEVGHAERRSLFGETDEMVAGKTHA
ALRHGLAPVECVGEPDQGPAELAVQVCLDQLERALAPARAAGTGGRLIVAYEPVWAIGAP
TPAPPEHVRAVCGALREHLRADPLFPDAAVIYGGSAGPGLLPTIVDAVDGMFLGRFAHDP
QAVRAVLDEVER
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggctgctcatcggctccagcctgaagatgtacttcgggcaccggcaaaccctg
gactgggtccgggccgtcgcggcgatctgcaccgagcatcccgcgaccgtgagcggggcc
gtcgagttcttcgtcatcccgacgttccccagcatcccggccgtggtcgagatcgcccgg
ccggccgggatcgcggtcggggcccaggatctgcactgggccgactccggaccgttcacc
ggcgaggtcagcgcggccgagctggccgagctcggctgcacgctggccgaggtggggcac
gccgaacgccggtcgctgttcggtgagaccgacgagatggtggccggcaagacccatgcg
gcgctgcggcacgggctggcgccggtggaatgcgtcggcgagcccgaccaggggccggcc
gagctcgccgtccaggtgtgcctggatcagctggaacgggccctggccccggcgcgggcg
gccggcaccggcggccggctgatcgtggcctacgagccggtctgggccatcggcgcgccg
accccggccccgccggagcacgttcgggcggtctgcggcgcgctgcgcgagcatctgcgg
gccgacccgctgttcccggacgccgcggtgatctacggcggcagcgccggacccggtctg
ttgcccaccatcgtcgacgcggtcgacgggatgttcctgggccggttcgcgcacgatcca
caggccgtgcgggccgtgctggacgaagtcgaacgctga

DBGET integrated database retrieval system