KEGG   Nakamurella multipartita: Namu_0057Help
Entry
Namu_0057         CDS       T00991                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nml  Nakamurella multipartita
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:nml01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nml01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nml00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:nml00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nml00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nml00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:nml00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
66660..68906
Genome map
AA seq 748 aa AA seqDB search
MTPPSPAKRRLAVMTSGGDAQGMNPAVRAVVRTALHYNADIYAIYEGYRGLIEGGDRIRP
ATFDDVSGILNRGGTVIGTARSLEFRERSGRLKAVHNLVEKGIDRLVVIGGDGSLSGADL
LRREWSSLINELVETGKIDQETADRHPALMITGLVGSIDNDMIGTDMTIGADSALHRIVE
AIDSISSTAASHQRSFIVEVMGRHCGYLALMSAIAGGADYVFIPENPPAPGWETHLCAQI
SNVRASGRRNSIVVVAEGAQDSDHNPIDSDYIRQVLEDRLGEDTRVTILGHVQRGGAPSA
FDRSMSSQQGFAAVEEVLSATADTVPSIIGVQHNRVAKAPLMESVAKTHELASLIAAKDY
DTALTLRGDSYTELSHVFHSISHALPGVRQKTKSSRIAVLNVGGLAPGMNAAARVAIRLG
LHRGHTILGVKGSFAGLAEGDVQEMQWGDVEGWSSRGGAELGISRKVPTVRDLYAIGRGL
ETHGIDGLVIIGGWDAFESAHTMWRERDRYEAFKIPMICLPASIDNNLPYSELSIGADSA
LNLIVDSIDRVRQAGAAQRRAFVVETMGGNCGYLALLAGLSGGAVRVYLHEEGITLKDLS
VDVERMVDSFRAGQRLFMVVANEKASPMYTSDFLCRLFEQESQDLFDARKVVLGQTQQGG
TPSPFDRILGTRLAAHAMDWISNEIDRSRADNAVIGTINGSVKVMSMRQAEDLADWENRR
PLKQWWMDLRPILDVLAQRLPVEQTRTF
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgccgagccccgccaagcgccgccttgccgtgatgaccagtggtggtgacgcg
cagggcatgaacccggccgtgcgcgccgtggtgcggaccgccctgcattacaacgcggac
atctacgccatctacgagggctaccggggtctgatcgagggcggcgaccggatccggccg
gcgacgttcgacgatgtcagcggcatcctcaaccggggcggcacggtgatcggcacggct
cggtcgctggagttccgcgagcggtcggggcggctcaaggcggtgcacaacctggtcgag
aagggcatcgaccggctcgtggtgatcggcggcgacggcagcctgtccggcgccgacctg
ctgcgccgggaatggtcgtcgctgatcaacgagctggtcgagaccggcaagatcgaccag
gagacggccgaccggcacccggcgctgatgatcaccggtctggtcgggtcgatcgacaac
gacatgatcggcaccgacatgacgatcggcgccgattcggcgctgcaccgcatcgtcgag
gcgatcgactccatctccagcaccgcggccagtcaccagcgcagcttcatcgtcgaggtg
atgggccggcactgcggttacctggccctgatgagcgcgatcgccggcggggccgattac
gtcttcatcccggagaacccgcccgccccgggctgggagacgcatctgtgcgcgcagatc
agcaatgtccgggcctccgggcgccgcaacagcatcgtcgtggtcgccgagggcgcgcag
gattccgaccacaacccgatcgacagcgactacatccgccaggtgctcgaggatcggctg
ggggaggacacccgggtcacgatcctgggccacgtccagcgcggtggtgcgcccagcgcg
ttcgaccgctcgatgagctcgcagcagggcttcgccgccgtcgaggaggtcctgtcggcc
accgcggacacggtgccctcgatcatcggcgtccagcacaaccgggtggccaaggcgccg
ttgatggaaagcgtggccaagacccatgagctggccagcctcatcgcggccaaggactac
gacaccgcgttgaccctgcgcggggacagctacaccgagctctcgcacgtcttccattcc
atctcgcacgcgctgcccggggtgcggcagaagaccaagtccagccgcatcgccgtgctc
aacgtgggcgggttggccccgggcatgaacgcggccgcccgcgtcgccatccggctcggc
ctgcaccgcgggcacaccatcctgggggtcaagggcagcttcgccggcctggccgagggt
gacgtgcaggagatgcagtggggtgacgtcgaaggctggagcagccggggcggggccgag
ctgggcatcagccgtaaggtgcccacggtccgggacctgtacgcgatcggccgcggcctg
gagacgcacggcatcgacgggttggtcatcatcggcgggtgggacgccttcgagtccgcc
cacaccatgtggcgggaacgggaccgctacgaggcgttcaagatcccgatgatctgcctg
ccggccagcatcgacaacaacctgccgtactccgagctgtccatcggcgcggacagcgcg
ctgaatctgatcgtcgattccatcgaccgggtccgccaggccggggccgcccagcgccgg
gccttcgtggtggagacgatgggcggcaactgcggttacctcgccttgctggccggcctg
tccggcggagcggtccgggtctacctgcacgaggagggcatcaccctcaaggatctctcg
gttgacgtcgagcggatggtggacagcttccgggccggtcagcgcctgttcatggtggtg
gccaacgaaaaggccagcccgatgtacaccagcgacttcctgtgccggctgttcgagcag
gagagccaggacctgttcgacgcccgcaaggtggtgctcggacagacccagcagggtggc
acaccgtcgccgttcgaccggatcctgggcacccggctggccgcgcacgccatggactgg
atcagcaacgagatcgaccgcagccgggccgacaacgccgtgatcggcacgatcaacggt
tcggtgaaggtcatgtcgatgcgtcaggccgaagatctggccgactgggagaaccgccgc
ccgttgaagcagtggtggatggacctgcggccgatcctggacgtgctggcccagcggctc
ccggtggagcagacccgcaccttctga

DBGET integrated database retrieval system