KEGG   Nakamurella multipartita: Namu_0113Help
Entry
Namu_0113         CDS       T00991                                 

Definition
pyridine nucleotide-disulfide oxidoreductase dimerisation subunit
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nml  Nakamurella multipartita
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:nml01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nml00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nml00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nml00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nml00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:nml00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
125448..126965
Genome map
AA seq 505 aa AA seqDB search
MTSPEPARKAADLAGESDVYDVVVIGGGPPGEIVAQYAIADSTRTAVIVEHELLGGECSY
WACMPSKALLRPVELLDAARHMPGVASLVAGRTIDVPAVLERRDGFTSHHDDKYQVQWAN
DTGIGVVRGHGRLAGPKQVEVTGADGATRIITARHAVVLATGTTASVPDLPGLRAALPWT
SRDVTNLHEVPRRVAVVGGGVVACESASWLHGLGVQELTILVRGGGLLDRNEPFAGELVA
QAFRDAGVKVLLHTGLDEVRRADPAATGEGRTHGGEVTLRFGDQTLVVDELVVAAGRTPA
SADLGLDAVGVDVGASHGFVTTDDQLAVRGVDGQWLYAVGDLTGRALLTHMGKYQGRICG
AVIAARAEGRPTDGSRFTDLADDGRVPQVTFTDPQVASVGRSERQARDAGLDVEAVEYDM
AGFAGSSLLRDGYVGRAKLVIDRTTDTLIGATFVGAEVAELVHAATVAVVGGVTLEQLWH
VVPSYPTMSEIWLKLLEARSAGKAH
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccccgagcccgcgcgcaaggcggccgacctggccggtgagtccgacgtctac
gacgtggtggtgatcggcggtggtccgcccggggagatcgtcgcccagtacgcgatcgcc
gacagcacccgcaccgcggtgatcgtcgagcacgaactgctcggcggcgagtgctcctat
tgggcctgcatgcccagcaaggcgctgctgcgcccggtcgagctgctggacgcggcccgg
cacatgcccggtgtcgcctccctggtcgccggccgcaccatcgacgtgccggccgtgctg
gagcgccgtgacgggttcaccagccaccacgacgacaagtaccaggtgcagtgggccaac
gacaccgggatcggggtcgtccgcgggcacggccggctggccggcccgaagcaggtcgag
gtgaccggcgccgacggcgccacccggatcatcaccgcgcggcacgcggtggtgctggcc
accgggacgaccgccagcgtgccggacctgccagggctgcgggccgcgctgccctggacc
tcgcgcgacgtcaccaacctgcatgaggtgccccggcgggtcgccgtggtcggtggtggg
gtcgtcgcctgcgagtcggccagctggctgcacgggctgggcgtgcaggagttgaccatc
ctggtccgtggcggggggctgctcgaccgcaacgagccgttcgccggcgaactggtggcc
caggccttccgggacgccggggtcaaggtcctgctgcacaccggtctggatgaggtccgg
cgcgccgacccggcggccaccggtgagggccgcacccacggcggtgaggtgaccctgcgg
ttcggcgaccagaccctggtggtggacgagctggtggtcgcggccgggcgcaccccggcc
agcgccgacctcggactggacgcggtgggcgtggacgtcggcgccagccacgggttcgtc
accaccgacgaccagctggccgtgcggggcgtcgacgggcagtggctgtacgcggtcggc
gacctgaccggccgggcgctgctgacccacatgggcaagtaccagggccgcatctgcggg
gcggtcatcgccgcccgggccgaaggtcgcccgaccgacgggtctcggttcaccgacttg
gccgacgacggccgggtgcctcaggtgaccttcaccgatccgcaggtcgcctccgtcggc
cggtccgagcggcaggctcgggacgccggcctggatgtcgaggccgtggagtacgacatg
gccggcttcgccgggtcctcactgctgcgggacgggtacgtcggtcgggccaagctggtg
atcgaccgaaccaccgacacgctgatcggcgccaccttcgtcggggccgaggtggccgag
ctggtgcacgccgccacggtcgccgtggtcggtggggtgacgctggagcagctgtggcac
gtcgtcccgtcgtacccgaccatgagcgagatctggctcaaactgctcgaggcccgcagc
gccggaaaagcccattga

DBGET integrated database retrieval system