KEGG   Nakamurella multipartita: Namu_0124Help
Entry
Namu_0124         CDS       T00991                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nml  Nakamurella multipartita
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_0124
   01230 Biosynthesis of amino acids
    Namu_0124
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_0124
   00030 Pentose phosphate pathway
    Namu_0124
   00051 Fructose and mannose metabolism
    Namu_0124
   00052 Galactose metabolism
    Namu_0124
  Energy metabolism
   00680 Methane metabolism
    Namu_0124
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Namu_0124
Enzymes [BR:nml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Namu_0124
Protein phosphatases and associated proteins [BR:nml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Namu_0124
Messenger RNA biogenesis [BR:nml03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Namu_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
138734..140053
Genome map
AA seq 439 aa AA seqDB search
MVTLADLQVRQLGECRHESPLAKYIAARRTNDHYVDESDRVLFDDTVHLVQDHGVPLTEL
PTLEPGGPRRQVFFPPGRTKVGIVTCGGLCPGLNDVIRGLVMELNTHYGVTDVVGFRNGY
AGLVPAHGYEPIALTTERVASINMQGGTILGTSRGAQDSEVMVDRLVELGIDILFVIGGD
GSIRGASKIAAVARGRGLDLSVIGIPKTIDNDIPFIGQSFGFQTAFTVAAQSIAAAQVEA
QSAVNGVGLVQLMGRHAGFIACYAALANHHADFVLIPEVPFALDGESGFLAALQRRVAER
GSAVVVVAEGAGQDLMADRAGTDASGNRKLGDIGRYLEAAIVGHYRALGRELTLKYLKPS
YSIRSVPAKAFDSVYCVRLAQAAAHAGMAGRTDMVVGRRHNRFVHVPIDIVVSHRNEVAP
DGDLWLSVLESTAQPPEMR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgctcgccgatctgcaggtgcgacagctgggtgaatgccgccatgagtcgccg
ctggccaagtacatcgcggcccgccggaccaacgatcactacgtcgatgagagcgaccgg
gtgctcttcgacgacaccgtgcacctggtccaggatcacggcgtcccgctgaccgagctg
cccacgctcgagcccggtgggccccgccgccaagtgttcttcccgcccggccgcaccaag
gtcggcatcgtgacctgcggtggcctgtgtcccgggctcaacgacgtgatccgcgggctg
gtcatggagctcaacacgcactacggggtcaccgacgtcgtcggcttccgcaacggctac
gccgggctggtgccggcccacgggtacgaaccgatcgccctgaccaccgaacgggtcgcc
tcgatcaacatgcagggcggcaccatcctgggcacctcccgcggcgcccaggacagcgag
gtgatggtcgaccggctggtcgagctgggcatcgacatcctgttcgtgatcggcggcgac
gggtcgatccgcggcgccagcaagatcgccgcggtcgcccggggacgcggcctggacctc
tcggtgatcggcatccccaagaccatcgacaacgacatccccttcatcgggcagagtttc
ggatttcagacggcgttcacggtggccgcccagtcgatcgccgcggcgcaggtggaggcc
cagtcggcggtcaacggggtcggcctggtccagctgatgggccggcacgccggattcatc
gcctgctatgccgcgctggccaaccaccacgccgacttcgtgctgatccccgaggtgccg
ttcgcgctggacggggagtcgggcttcctggccgcgttgcaacggcgggtggccgagcgg
ggcagcgccgtggtcgtggtggccgagggcgccggtcaggacctgatggccgaccgggcc
ggcacggacgcctcgggcaaccgcaagctgggggacatcgggcggtacctcgaggcggcc
atcgtcggtcactaccgcgccctgggccgcgagctgaccctcaagtacctcaagccgagc
tattcgatccgttcggtgccggccaaggccttcgattcggtctactgcgtccggctggcc
caggccgccgcgcacgccgggatggccggccgcaccgacatggtcgtcggccggcggcac
aaccggttcgtgcacgtgccgatcgacatcgtcgtctcgcaccgcaacgaggtcgccccg
gacggcgacctgtggctctcggtgctggagtcgaccgcgcagccgccggagatgcgctga

DBGET integrated database retrieval system