KEGG   Nakamurella multipartita: Namu_0159Help
Entry
Namu_0159         CDS       T00991                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nml  Nakamurella multipartita
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Namu_0159
Enzymes [BR:nml01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Namu_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
174301..176418
Genome map
AA seq 705 aa AA seqDB search
MDTRTSREAAAAAMRTFPFTAVVGSDDMALALILTTVSPEVGGVLVRGEKGTAKSTMVRA
LAGLLPAVDVIEGCRFSCDPADPDPACPDGPHPAGAPATTRPAKLVELPVGATEDRVIGS
LHLEKALTAGVTEYEPGLLAAAHRGLLYVDEVNLLHDHLVDLLLDAAAMGRGTVEREGVS
IAHAARFVLVGTMNPEEGELRPQLLDRFGLTVEIAAPRDPAVRAEVVRRRLAYDADPDTV
AARYADAEADLARRIRSARTGLPTVVLGDGALTKIAQVCASFEVDGMRADLVTARAAVAH
AAWHGRRYVTREDIRAAARLALPHRRRRNPFDAPGLDEELLDRILGDDEPDPPPPGPEVD
PSPQAPADAGSEPADGPRTEAGSDADSGSDFDSGSDLERVEEPATAQAADPATEPDRASN
PTPATGPAPAGTVSGTGQPFRPKLFTVAGVGAGEPGRRSRAITSNGRTVGATPFVGRGGA
VHLTATVRAAAPHQRRRGRTGPGLLVGRDDLRLAVKQGREANLVLFCVDASGSMAARARM
EAVKAAVLSLLTDAYQRRDKVGLVTFRGGAADLALPPTSSVEAAARRLEMLPAGGRTPLA
EGLLCAAHTLRVERIRDPRRRPLLVVVTDGRATSGPDAVARSRRAATALAAEGIAALVLD
CETGRFRMGLAARLAEHLQADYVPITDVAASVLTTSVARHRARVA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
gtggacacccgcacgagtcgagaggcggccgctgccgcgatgcgcacgttcccgttcacc
gccgtcgtcggctccgacgacatggccctcgcgctgatcctgaccaccgtctcgcccgag
gtcggcggcgtgctggtgcggggagagaagggcaccgccaagtcgaccatggttcgcgcg
ctggccggactgctgcccgcggtcgacgtcatcgagggctgccggttctcctgcgacccg
gccgaccccgatccggcctgcccggacggcccgcatccggccggtgccccggccaccacc
cgcccggccaagctggtcgagctgccggtcggcgcgaccgaggaccgggtgatcggctcg
ctgcacctggagaaggcgctgaccgccggggtcaccgagtacgagcccggcctgctggcc
gccgcccaccgtggcctgctctacgtcgacgaggtcaacctgctgcacgaccacctggtc
gacctgctgctggacgccgccgcgatgggccgcggcaccgtggaacgcgagggcgtgtcg
atcgcccacgccgcccggttcgtgctggtcggcacgatgaacccggaagagggcgagctg
cgcccgcagctgctggaccgcttcgggctgaccgtcgagatcgccgccccgcgggacccg
gcggtgcgggccgaggtagtgcggcgccggctggcctacgacgccgacccggacaccgtc
gccgcccgctacgccgacgccgaggcggacctggcccgacgcatccggtccgcccggacc
gggttgcccacggtggtgctgggcgacggcgccttgaccaagatcgctcaggtctgtgcg
tcgttcgaggtcgacggcatgcgcgccgacctggtcaccgcccgcgccgccgtcgcgcac
gccgcctggcacggccgccgctacgtcacccgtgaggacatccgggccgccgcccggctg
gccctgccgcatcggcgccgccgcaacccgttcgacgcgccggggctggacgaggagctg
ctcgaccggatcctcggcgacgacgagcccgacccgccgcccccgggaccggaggtcgac
cccagcccgcaggcgccggccgacgccgggtccgaaccggcggacggcccccgcaccgag
gccggctccgacgctgactccggctcggactttgactccggctccgacttggaacgggtc
gaggaaccggcgaccgcccaggccgccgacccggcaaccgaaccagaccgggccagcaac
ccgaccccggccaccggcccggcccccgccggaaccgtgtccggcaccggacaaccgttc
cggcccaagctgttcaccgtcgccggggtcggcgccggggagccggggcggcgctcccgc
gcgatcaccagcaacggccggaccgtcggcgccaccccgttcgtcgggcgaggtggcgcg
gtgcacctgaccgcgaccgtccgggccgccgccccccatcagcgtcgccgcggccgcacc
gggccgggcctgctggtcggccgggacgacctgcggctggcggtcaagcagggtcgcgag
gccaacctggtgctgttctgcgtcgacgcctccgggtcgatggccgcccgcgcccggatg
gaggcggtcaaggccgccgtgctgtccctgctcaccgacgcctaccagcggcgggacaag
gtcgggctggtcaccttccgcgggggcgccgcggacctggcgttgccgccgacgtcgtcg
gtggaggcggccgcgcggcggctggaaatgctgccggccggcggtcgcaccccgctggcc
gagggcctgctgtgcgcggcgcacaccctgcgggtggagcggatccgggacccgcggcgc
cgtccgctgctggtcgtcgtcaccgacgggcgggccacctccggaccggatgcggtggcc
cggtcccgccgggcagccaccgcgctggccgccgaagggatcgccgccctcgtcctggac
tgcgagaccggccggttccggatgggactggccgcgcggctggccgagcacctgcaggcc
gactacgtgccgatcaccgacgtcgcggcctccgtgctgaccacctcggtggcccgtcac
cgggcgcgggtggcctga

DBGET integrated database retrieval system