KEGG   Nakamurella multipartita: Namu_0210Help
Entry
Namu_0210         CDS       T00991                                 

Definition
(GenBank) DNA-(apurinic or apyrimidinic site) lyase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
nml  Nakamurella multipartita
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:nml00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Namu_0210
Enzymes [BR:nml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Namu_0210
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Namu_0210
DNA repair and recombination proteins [BR:nml03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Namu_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
238680..239564
Genome map
AA seq 294 aa AA seqDB search
MPELPEVTALAAFLTEHAGGQRITAVSVAALNVLTTYDPPASALVGRTVTGAGRHGKFLD
LVTAPGPDASPGTPDALHLILHLARAGWLRWSDAISPRPPKMGGPIALRVALSGGGGFDV
TEAGTKKSVTAAVVTDPRAVPGVARLGPDALDLDRAALAQVLATQTGRIKNVLTDQRVIA
GVGNAYSDEILHTARLSPFATAAKLSPDELDRLYDALATVLTDAVLRSVGGQAARLKGEK
RTGLRVHARTGLPCPVCGDVVAEVSFADRSFQYCPTCQTGGKKLADRRLSRLVK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctcccggaggtcaccgcgctggccgcgttcctgaccgagcacgccggcggg
cagcgcatcaccgcggtgagcgtggccgcactcaacgtgctcaccacctacgacccgccc
gcgtccgccctggtcggccggaccgtgaccggggccggccggcacggcaagttcctggac
ctggtcaccgccccgggcccggacgcgtcgccggggaccccggacgcgctgcacctgatc
ctgcacctggcccgggccgggtggctgcgctggtcggacgccatctcgccgcggccgccg
aagatgggtgggccgatcgccctgcgggtcgccctcagcggcggcggcgggttcgacgtg
accgaggccggcaccaagaagtcggtgacggcggcggtggtgaccgacccgcgagcggtc
cccggggtggcccggctcggcccggacgcgctggacctggaccgcgcggcgctcgcgcag
gtgctggccacccagaccggccggatcaagaacgtgctcaccgaccagcgggtgatcgcc
ggcgtcggcaacgcttactcggacgagatcctgcacaccgcgcggctctcgccgttcgcg
acggcggccaagctgtccccggacgagctcgatcggctctacgacgcgctggccaccgtg
ctcaccgacgccgtgctgcgctcggtcggcggtcaggccgcccggctcaagggggaaaag
cgcaccgggctgcgggtgcatgcgcgcaccggcctgccctgcccggtctgcggggacgtc
gtcgccgaggtctcgttcgccgaccggtccttccagtactgcccgacgtgccagaccggc
ggcaagaagctggccgaccgccggctgtcccggctggtcaagtaa

DBGET integrated database retrieval system