KEGG   Nakamurella multipartita: Namu_0238Help
Entry
Namu_0238         CDS       T00991                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
nml  Nakamurella multipartita
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Namu_0238
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Namu_0238
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Namu_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
267405..268298
Genome map
AA seq 297 aa AA seqDB search
MAIVLGKNQYGKAEVRMVYVDRSTPVHAITDVNVTSQLIGDFTDTHLTGANDAVIATDTQ
KNTVYAMARTGGVGSPEEFALRLARNYVDKYEQVTGARMAVEQYSWDRIVTAAGPHDHAF
SKGTAETRTAVVRKDGAAETVISGLTGLVVLKSTGSEFWGFPEVEYTSLVETNDRILATA
VTARWLYTTSELDWDAAFTAVRGALLENFANTHSLSLQQTLYAMGKGALEAVPEIAEIRL
SLPNKHHFLVDLDKWDLDNPNQVFYAADRPYGLIEAAILRDDAEVPDGAWEGIAAFI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgtgctcgggaagaaccagtacggcaaggccgaggtgcggatggtctacgtc
gaccgcagcacccccgtccacgccatcacggatgtcaacgtgaccagccaactgatcggt
gatttcaccgacacccacctgaccggcgcgaacgacgccgtcatcgccaccgacacccag
aagaacacggtgtacgcgatggcccgcaccggcggcgtcggctcgccggaagaattcgcg
ctgcgcctggcccgcaactacgtcgacaagtacgagcaggtcaccggggcccggatggcc
gtcgagcagtattcgtgggaccggatcgtcaccgcggccggcccgcacgaccacgccttc
tccaagggcaccgccgagacccggaccgcggtggtgcgcaaggacggggccgccgagacg
gtgatctccgggctgaccgggctggtcgtgctcaagtccaccggcagcgagttctggggc
ttccccgaggtcgagtacacctcgctggtggagaccaacgatcggatcctggccaccgcg
gtgaccgcccgctggctgtacacgaccagcgagctggactgggatgcggcgttcaccgcg
gtgcggggcgccctgctggagaacttcgcgaatacgcacagcctgtcgctgcagcagacg
ctgtacgcgatgggcaagggggcgttggaggcggtgccggagatcgccgagatccggctg
tccctgccgaacaagcaccacttcctggtcgatctggacaagtgggacctggacaacccg
aaccaggtcttctacgcggctgaccggccctacgggctgatcgaggcggcgatcctgcgg
gacgacgccgaggtgccggacggcgcctgggaggggatcgccgcgttcatctga

DBGET integrated database retrieval system