KEGG   Nakamurella multipartita: Namu_0285Help
Entry
Namu_0285         CDS       T00991                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nml  Nakamurella multipartita
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nml00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
318911..319981
Genome map
AA seq 356 aa AA seqDB search
MGMARYGSMYGPDITFTGVPRCDLADPASYTDAVAVILGAPYDAGTSYRAGARMGPMALR
SCDYSEHTGSRPHLALRVDPLLDLGVVDAGDVEMAPTETQRSLAALQDAVLTLARAGKIP
VVLGGDHTVAQPDITALAEHFGYGRLAVIHFDAHADTGDIQFGSLYGHGLPMRRVIESGA
VRGEKFLQIGLRGYWPEPPELAWMAEQGMRCYEMAEIARRGLDRVLTEAMTIATQDTDGV
YLSVDIDVCDPAAAPGTGTPEPGGLTARELLDAVRRIGRAVPLVGLEIVEVAPPYDHADI
TAMLGNRVVLETLSGIARRRADAAAGTVWDEATPLMAGRVSAAPPPVEPPEHERSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtatggccagatacggctcgatgtacggaccggacatcaccttcaccggggtgccg
cgctgcgacctggctgatccggccagctataccgacgcggtcgcggtgatcctgggggcg
ccgtacgacgccggcacctcataccgggccggggcgcggatggggccgatggccctgcgc
agctgcgattactccgagcacaccggctcccggccgcacctggccctgcgggtggatccg
ctgctggacctcggggtcgtcgacgccggtgacgtcgagatggccccgaccgagacccag
cggtcattggccgccctgcaggacgccgtgctgacgctggcccgggccggcaagatcccg
gtcgtgctgggtggtgaccacaccgtcgcccagcccgacatcaccgcactggccgagcat
ttcggctacggtcggctggccgtcatccacttcgatgcgcacgccgacaccggcgacatc
cagttcggctcgctgtacgggcacggcctgccgatgcgccgggtgatcgagtccggcgcg
gtgcggggcgagaagttcctgcagatcggcctgcgcgggtattggccggaaccgcccgag
ctggcctggatggccgagcagggcatgcgctgctacgagatggccgagattgcccgccgt
ggcctggatcgcgtgctcaccgaggccatgacgatcgccacccaggacaccgacggggtc
tacctgtcggtggacatcgatgtctgcgacccggccgccgcgcccggtaccggcaccccc
gaacccggcgggctgaccgcccgcgaactgctcgacgcggtccggcggatcggccgggcg
gtgccgttggtgggcctggaaatcgtcgaggtggccccgccgtacgaccacgcggacatc
acggcgatgctgggcaaccgggtggtgctggaaaccctgtccggcatcgcccgccgccgg
gccgacgcggccgccggcaccgtctgggacgaggcgaccccgctgatggccggccgggtg
tcggccgccccgccgccggtggagccaccggagcacgagcgctcgctctga

DBGET integrated database retrieval system