KEGG   Nakamurella multipartita: Namu_0536Help
Entry
Namu_0536         CDS       T00991                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
nml  Nakamurella multipartita
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Namu_0536
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Namu_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
595051..596076
Genome map
AA seq 341 aa AA seqDB search
MRAVRVVGYHRNLELTEVPKPEITGPHDVIVKIGGAGVCRTDLHILEGQWEPKTHVALPY
TIGHENAGWVDAVGSAVTNVKVGDKVIMHPLITCGLCRACRFGDDVHCENSQFPGIDTEG
GYADYLKTSARSVVKIDDSLEPADVAALADAGLTAYHAAAKAARKLRPGDRCVMIGAGGL
GHIGIQVLKALSPADLIVVDRNPAALELAKSIGADITVVADGTEVQQILDITGGHGAEQV
IDFVGEGGSTAKGLDMTRRAGDYHVVGYGENVDIATIDLISTERNIIGNLVGSYNDLVEL
MALAARGKVTLHTAKYRLDQFQDALDDLDAGKVRGRAILIP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagtacgcgtggtcggttaccaccgcaacctcgagctgaccgaggtgcccaag
cccgagatcaccgggccgcacgacgtgatcgtcaagatcggtggggccggggtctgccgg
accgacctgcacatcctcgaaggccagtgggagcccaagacccacgtggccctgccgtac
acgatcgggcacgagaacgccggctgggtcgacgccgtcggcagcgccgtcaccaacgtc
aaggtcggcgacaaggtgatcatgcatccgctgatcacctgcgggctgtgccgggcctgc
cgcttcggtgacgacgtgcactgcgagaactcccagttcccgggcatcgacaccgagggt
ggttacgccgactacctcaagacctccgcccgcagcgtcgtcaagatcgacgattcgctg
gagccggccgacgtcgccgcgctggccgacgccgggctgaccgcctaccacgcggccgcc
aaggcggcccgcaagctgcgccccggcgaccggtgcgtgatgatcggcgccggcggtctg
ggacacatcgggatccaggtgctcaaggcgctctcgccggccgacctgatcgtggtcgat
cgcaacccggccgccctggagctggccaagtccatcggcgccgacatcacggtggtggcc
gacggcaccgaggtgcagcagatcctggacatcaccggcgggcacggggccgagcaggtc
atcgacttcgtcggtgagggcgggtccaccgccaagggtctggacatgacccggcgggcc
ggcgactaccacgtcgtcgggtacggcgagaacgtcgacatcgcgaccatcgatctgatc
tccaccgagcgcaacatcatcggcaacctggtcggcagctacaacgacctggtcgagctc
atggcgctggccgctcggggcaaggtcaccctgcatacggccaagtaccgcctcgatcag
ttccaggacgccctggacgacctggacgccggcaaggtgcgcggacgggccatcctcatc
ccgtag

DBGET integrated database retrieval system