KEGG   Nakamurella multipartita: Namu_0555Help
Entry
Namu_0555         CDS       T00991                                 

Definition
(GenBank) anti-sigma-factor antagonist
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
nml  Nakamurella multipartita
Pathway
nml00220  Arginine biosynthesis
nml00250  Alanine, aspartate and glutamate metabolism
nml00471  D-Glutamine and D-glutamate metabolism
nml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Namu_0555
   00220 Arginine biosynthesis
    Namu_0555
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Namu_0555
Enzymes [BR:nml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Namu_0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase cNMP_binding STAS
Motif
Other DBs
NCBI-ProteinID: ACV76971
UniProt: C8X7A2
Position
615966..617771
Genome map
AA seq 601 aa AA seqDB search
MKSLVQDYIDGVYRDLTGERSGSVADYIPELAVVDPDSFAICLATSDGYVYEAGDSRKKF
AIQSISKPFTYALALADRGLAAVATKVDVEPSGEPFNEISLDPVTERPRNPMINAGAITS
ASLVAGATVAERFERIRRFYSRFAGRELTLNESMFESEDRTGNRNRAIGYLLREYGILEE
DPQTTLGVYFRQCSIEVDCRDLSLMAATLADSGVHPVSGDRVLDAGLNERVLSVMTTCGM
YNAAGDWVTEVGLPAKSGVGGGILAVLPGQLGLAVFSPRLDEHGNSVRGVRSCRRISKDL
ELHFMHVSRAARSAVRASYDVIDRPSRRRRSPAEHDLLLRVGQRARIYELHGDLLFAGAE
SVVRKLTLDADELDVIVLDIRGVDETAAVTRTMMRTVRDWLRADGVEAVIVDPQSTVLEL
DPDPAKRLRHFGDLNEAVGYAEDVLLARHAGADAQARAIPIRDHPLLSGLPPEQLEAIVT
RLVPHTYDAGDSVVRSGDPTQGLFLITAGPVEVSVELAGTRHHLSMFTAGTTFGVAYAVA
GREYDVDATAQGEVAAMVLPAPAIAELTATAPDLMLTLMSRLVTGAFDHLDWVTRALVSP
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgctggtgcaggactacatcgacggggtgtaccgggacctgaccggggagcgg
tcggggtcggtggccgactacatccccgagctggcggtggtcgacccggactcgttcgcg
atctgcctggccaccagcgacggctacgtctacgaggccggggacagccgcaagaagttc
gcgatccagtcgatctccaagcccttcacctacgccctggccctggccgaccgggggctg
gccgcggtggccaccaaggtcgacgtcgaaccgtcgggcgaaccgttcaacgagatcagc
ctggacccggtcaccgaacgcccacgcaacccgatgatcaacgcgggggcgatcacgtcc
gcctcgctggtcgccggcgcgaccgtggccgaacggttcgagcggatccgccggttctac
tcccgcttcgccggccgtgagctgaccctgaacgagtcgatgttcgagtccgaggaccgc
accggcaaccgcaaccgggcgatcggctacctgctgcgcgagtacgggatcctcgaggag
gacccgcagaccaccctgggggtgtacttccggcagtgctcgatcgaggtcgactgccgg
gacctgagcctgatggcggccacgctggccgacagcggcgtgcacccggtcagcggggac
cgggtgctcgacgccggcctgaacgagcgggtgctgtcggtgatgaccacctgcggcatg
tacaacgcggccggcgactgggtgaccgaggtcgggctgccggccaagagcggcgtcggc
ggcggcatcctggccgtgctgcccggccagctcgggctcgcggtgttctccccgcggctg
gacgagcacggcaacagcgtgcgcggcgtccgatcgtgccggcggatctccaaggacctg
gagctgcacttcatgcacgtcagccgggccgcgcggtccgcggtccgggcgtcctacgac
gtgatcgaccggccgtcccggcgccggcgcagcccggccgagcacgacctgctgctccgg
gtcggccagcgggcccggatctacgagctgcacggcgacctgctgttcgccggggccgag
tcggtggtccgcaagctgaccctggacgccgacgagctggacgtgatcgtgctggacatc
cgcggcgtcgacgagaccgccgcggtcacccggacgatgatgcgcaccgtgcgggactgg
ctgcgggccgacggagtggaggcggtgatcgtcgatccgcagtcgaccgtgctggaactg
gaccccgacccggccaagcggctgcggcacttcggcgacctgaacgaggccgtcggctac
gccgaggacgtgttgctggcccggcacgccggggccgatgcccaggcccgggcgatcccg
atccgcgaccatcccctgctcagcgggctgccgccggagcagctcgaggcgatcgtgacc
cggctggtgccgcacacctacgatgccggcgactccgtcgtgcgcagcggcgatccgacc
cagggcctgttcctgatcaccgccggaccggtcgaggtcagcgtggagctggccggcacc
cggcaccacctgtcgatgttcaccgccggcacgacgttcggtgtcgcctacgcggtggcc
ggtcgggagtacgacgtggacgccaccgctcagggtgaggtggcggcgatggtcctgccg
gcgccggccatcgccgagctgaccgccaccgcgccggacttgatgctgaccctgatgagc
cggctggtcaccggcgcgttcgaccatctggactgggtgacgcgggcgctggtgtccccg
agctga

DBGET integrated database retrieval system