KEGG   Nakamurella multipartita: Namu_0555Help
Entry
Namu_0555         CDS       T00991                                 

Definition
anti-sigma-factor antagonist (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
nml  Nakamurella multipartita
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Namu_0555
   00330 Arginine and proline metabolism
    Namu_0555
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Namu_0555
Enzymes [BR:nml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Namu_0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
615966..617771
Genome map
AA seq 601 aa AA seqDB search
MKSLVQDYIDGVYRDLTGERSGSVADYIPELAVVDPDSFAICLATSDGYVYEAGDSRKKF
AIQSISKPFTYALALADRGLAAVATKVDVEPSGEPFNEISLDPVTERPRNPMINAGAITS
ASLVAGATVAERFERIRRFYSRFAGRELTLNESMFESEDRTGNRNRAIGYLLREYGILEE
DPQTTLGVYFRQCSIEVDCRDLSLMAATLADSGVHPVSGDRVLDAGLNERVLSVMTTCGM
YNAAGDWVTEVGLPAKSGVGGGILAVLPGQLGLAVFSPRLDEHGNSVRGVRSCRRISKDL
ELHFMHVSRAARSAVRASYDVIDRPSRRRRSPAEHDLLLRVGQRARIYELHGDLLFAGAE
SVVRKLTLDADELDVIVLDIRGVDETAAVTRTMMRTVRDWLRADGVEAVIVDPQSTVLEL
DPDPAKRLRHFGDLNEAVGYAEDVLLARHAGADAQARAIPIRDHPLLSGLPPEQLEAIVT
RLVPHTYDAGDSVVRSGDPTQGLFLITAGPVEVSVELAGTRHHLSMFTAGTTFGVAYAVA
GREYDVDATAQGEVAAMVLPAPAIAELTATAPDLMLTLMSRLVTGAFDHLDWVTRALVSP
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgctggtgcaggactacatcgacggggtgtaccgggacctgaccggggagcgg
tcggggtcggtggccgactacatccccgagctggcggtggtcgacccggactcgttcgcg
atctgcctggccaccagcgacggctacgtctacgaggccggggacagccgcaagaagttc
gcgatccagtcgatctccaagcccttcacctacgccctggccctggccgaccgggggctg
gccgcggtggccaccaaggtcgacgtcgaaccgtcgggcgaaccgttcaacgagatcagc
ctggacccggtcaccgaacgcccacgcaacccgatgatcaacgcgggggcgatcacgtcc
gcctcgctggtcgccggcgcgaccgtggccgaacggttcgagcggatccgccggttctac
tcccgcttcgccggccgtgagctgaccctgaacgagtcgatgttcgagtccgaggaccgc
accggcaaccgcaaccgggcgatcggctacctgctgcgcgagtacgggatcctcgaggag
gacccgcagaccaccctgggggtgtacttccggcagtgctcgatcgaggtcgactgccgg
gacctgagcctgatggcggccacgctggccgacagcggcgtgcacccggtcagcggggac
cgggtgctcgacgccggcctgaacgagcgggtgctgtcggtgatgaccacctgcggcatg
tacaacgcggccggcgactgggtgaccgaggtcgggctgccggccaagagcggcgtcggc
ggcggcatcctggccgtgctgcccggccagctcgggctcgcggtgttctccccgcggctg
gacgagcacggcaacagcgtgcgcggcgtccgatcgtgccggcggatctccaaggacctg
gagctgcacttcatgcacgtcagccgggccgcgcggtccgcggtccgggcgtcctacgac
gtgatcgaccggccgtcccggcgccggcgcagcccggccgagcacgacctgctgctccgg
gtcggccagcgggcccggatctacgagctgcacggcgacctgctgttcgccggggccgag
tcggtggtccgcaagctgaccctggacgccgacgagctggacgtgatcgtgctggacatc
cgcggcgtcgacgagaccgccgcggtcacccggacgatgatgcgcaccgtgcgggactgg
ctgcgggccgacggagtggaggcggtgatcgtcgatccgcagtcgaccgtgctggaactg
gaccccgacccggccaagcggctgcggcacttcggcgacctgaacgaggccgtcggctac
gccgaggacgtgttgctggcccggcacgccggggccgatgcccaggcccgggcgatcccg
atccgcgaccatcccctgctcagcgggctgccgccggagcagctcgaggcgatcgtgacc
cggctggtgccgcacacctacgatgccggcgactccgtcgtgcgcagcggcgatccgacc
cagggcctgttcctgatcaccgccggaccggtcgaggtcagcgtggagctggccggcacc
cggcaccacctgtcgatgttcaccgccggcacgacgttcggtgtcgcctacgcggtggcc
ggtcgggagtacgacgtggacgccaccgctcagggtgaggtggcggcgatggtcctgccg
gcgccggccatcgccgagctgaccgccaccgcgccggacttgatgctgaccctgatgagc
cggctggtcaccggcgcgttcgaccatctggactgggtgacgcgggcgctggtgtccccg
agctga

  All links  
No link information was found.   
DBGET integrated database retrieval system