KEGG   Nakamurella multipartita: Namu_0593Help
Entry
Namu_0593         CDS       T00991                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nml  Nakamurella multipartita
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Namu_0593
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_0593
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Namu_0593
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Namu_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(652133..653491)
Genome map
AA seq 452 aa AA seqDB search
MPIRQHKYLLDESEMPTSWYNIVPDLPAPPPPPLHPGTHEPVGPDDLAPLFPMDLILQEV
STERYIPIPDEVQDVYRLWRPSPLFRAHRLEQALGTPARIYYKYEGVSPAGSHKPNTAVP
QVYYNAKAGVKKLTTETGAGQWGTALAFACSLFDVECEVWQVGASYDAKPYRRTVIETFG
GTVHRSPSQLTSAGRAFAADHPGSLGIAISEAVEKAAGAADTKYALGSVLNHVLLHQTVI
GEEALLQLAKAGETGADLVIGCTGGGSNFGGLAFPFLREKLAGRQNPVIRAVEPASCPSL
TRGEYRYDFGDTAGFTPLMKMHTLGHDFVPDPIHAGGLRYHGMAPLISHIYELGLMEALS
IEQTECFAAAVRFARTEGIVPAPEPTHALAATMREALACKESGEEKVIVTALCGHGLLDL
GAYDAYLNDRMVDSGLSDADLDAALSTIPVLT
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcccattcggcagcacaagtaccttctcgacgaatccgagatgcccaccagctggtac
aacatcgtgccggatctgccggccccgcccccgccgccgctgcacccgggcacccacgaa
ccggtcggcccggacgacctggccccgctgttcccgatggacctgatcctgcaggaggtc
tcgaccgagcggtacatcccgatcccggacgaggtgcaggacgtctaccggctgtggcgg
ccctcgcccctgttccgggcacaccgcctggaacaggcgctgggcacgccggcccggatc
tactacaagtacgagggcgtctccccggccggctcgcacaagccgaacacggcggtgccg
caggtctattacaacgccaaggccggcgtgaagaagctgaccaccgagaccggcgccggc
caatggggcaccgcgctggcgttcgcctgctcgctgttcgacgtcgagtgcgaggtctgg
caggtcggcgcgtcctacgacgccaagccctaccggcgcacggtcatcgagacgttcggc
ggcacggtgcaccgctcaccgtcccagctgacctcggccgggcgggcgttcgccgcggat
caccccggatcgctgggcatcgccatctccgaggccgtggagaaggctgcgggagccgcc
gacaccaagtacgcgctgggctcggtcctcaatcacgtgctgttgcaccagacggtgatc
ggcgaggaagcgctgctgcagctggccaaggccggcgagaccggtgccgacctggtgatc
ggctgtaccggcggcggctccaacttcggcggcctggcgttcccgttcctgcgggagaag
ctggccggccggcagaacccggtgatccgcgcggtcgagccggcctcgtgcccgtcgttg
acccgcggcgagtaccgctacgacttcggcgacaccgccggcttcacgccgctgatgaag
atgcacaccctgggccacgatttcgtgccggacccgatccacgccggtggcctgcgctat
cacggcatggccccgctgatctcgcacatttacgagctcgggctgatggaggcgctgtcc
atcgagcagaccgagtgcttcgccgccgcggtccggttcgcccgcaccgagggcatcgtg
ccggcccccgaacccacgcacgcgctggccgccaccatgcgcgaggcgttggcctgcaag
gaatccggcgaggagaaggtgatcgtgacggcgctgtgcgggcacggcctgctggacctg
ggcgcctatgacgcctacctcaacgaccggatggtcgactccgggctctcggacgccgac
ctggacgcggcgctgtcgacgattcccgtcctgacatga

DBGET integrated database retrieval system